TMPRSS4 (NM_183247) Human Mass Spec Standard
CAT#: PH302384
TMPRSS4 MS Standard C13 and N15-labeled recombinant protein (NP_899070)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC202384 |
| Predicted MW | 37.2 kDa |
| Protein Sequence |
>RC202384 protein sequence
Red=Cloning site Green=Tags(s) MDPDSDQPLNSLDVKPLRKPRIPMETFRKVGIPIIIALLSLASIIIVVVLIKVILDKYYFLCGQPLHFIP RKQLCDGELDCPLGEDEEHCVKSFPEGPAVAVRLSKDRSTLQVLDSATGNWFSACFDNFTEALAETACRQ MGYSSKPTFRAVEIGPDQDLDVVEITENSQELRMRNSSGPCLSGSLVSLHCLACGKSLKTPRVVGGEEAS VDSWPWQVSIQYDKQHVCGGSILDPHWVLTAAHCFRKHTDVFNWKVRAGSDKLGSFPSLAVAKIIIIEFN PMYPKDNDIALMKLQFPLTFSGTVRPICLPFFDEELTPATPLWIIGWGFTKQNGG myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_899070 |
| RefSeq Size | 1983 |
| RefSeq ORF | 1005 |
| Synonyms | membrane-type serine protease 2; MT-SP2; MT-SP2, TMPRSS3; TMPRSS3; transmembrane protease, serine 4; transmembrane serine protease 3; type II membrane serine protease |
| Locus ID | 56649 |
| Cytogenetics | 11q23.3 |
| Summary | This gene encodes a member of the serine protease family. Serine proteases are known to be involved in a variety of biological processes, whose malfunction often leads to human diseases and disorders. This gene was identified as a gene overexpressed in pancreatic carcinoma. The encoded protein is membrane bound with a N-terminal anchor sequence and a glycosylated extracellular region containing the serine protease domain. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Protease, Transmembrane |
Documents
| FAQs |
| SDS |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC405242 | TMPRSS4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC412678 | TMPRSS4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC430655 | TMPRSS4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC432994 | TMPRSS4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY405242 | Transient overexpression lysate of transmembrane protease, serine 4 (TMPRSS4), transcript variant 2 |
USD 436.00 |
|
| LY412678 | Transient overexpression lysate of transmembrane protease, serine 4 (TMPRSS4), transcript variant 1 |
USD 436.00 |
|
| LY430655 | Transient overexpression lysate of transmembrane protease, serine 4 (TMPRSS4), transcript variant 2 |
USD 396.00 |
|
| LY432994 | Transient overexpression lysate of transmembrane protease, serine 4 (TMPRSS4), transcript variant 5 |
USD 436.00 |
|
| PH303972 | TMPRSS4 MS Standard C13 and N15-labeled recombinant protein (NP_063947) |
USD 2,055.00 |
|
| PH324725 | TMPRSS4 MS Standard C13 and N15-labeled recombinant protein (NP_001077416) |
USD 2,055.00 |
|
| TP302384 | Recombinant protein of human transmembrane protease, serine 4 (TMPRSS4), transcript variant 2 |
USD 823.00 |
|
| TP303972 | Recombinant protein of human transmembrane protease, serine 4 (TMPRSS4), transcript variant 1 |
USD 748.00 |
|
| TP324725 | Purified recombinant protein of Homo sapiens transmembrane protease, serine 4 (TMPRSS4), transcript variant 3 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China