TMPRSS4 (NM_001083947) Human Mass Spec Standard
CAT#: PH324725
TMPRSS4 MS Standard C13 and N15-labeled recombinant protein (NP_001077416)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC224725 |
Predicted MW | 47.5 kDa |
Protein Sequence |
>RC224725 representing NM_001083947
Red=Cloning site Green=Tags(s) MLQDPDSDQPLNSLDVKPLRKPRIPMETFRKVGIPIIIALLSLASIIIVVVLIKVILDKYYFLCGQPLHF IPRKQLCDGELDCPLGEDEEHCVKSFPEGPAVAVRLSKDRSTLQVLDSATGNWFSACFDNFTEALAETAC RQMGYSRAVEIGPDQDLDVVEITENSQELRMRNSSGPCLSGSLVSLHCLACGKSLKTPRVVGGEEASVDS WPWQVSIQYDKQHVCGGSILDPHWVLTAAHCFRKHTDVFNWKVRAGSDKLGSFPSLAVAKIIIIEFNPMY PKDNDIALMKLQFPLTFSGTVRPICLPFFDEELTPATPLWIIGWGFTKQNGGKMSDILLQASVQVIDSTR CNADDAYQGEVTEKMMCAGIPEGGVDTCQGDSGGPLMYQSDQWHVVGIVSWGYGCGGPSTPGVYTKVSAY LNWIYNVWKAEL myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001077416 |
RefSeq Size | 3534 |
RefSeq ORF | 1296 |
Synonyms | CAPH2; MT-SP2; TMPRSS3 |
Locus ID | 56649 |
UniProt ID | Q9NRS4 |
Cytogenetics | 11q23.3 |
Summary | This gene encodes a member of the serine protease family. Serine proteases are known to be involved in a variety of biological processes, whose malfunction often leads to human diseases and disorders. This gene was identified as a gene overexpressed in pancreatic carcinoma. The encoded protein is membrane bound with a N-terminal anchor sequence and a glycosylated extracellular region containing the serine protease domain. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Protease, Transmembrane |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405242 | TMPRSS4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC412678 | TMPRSS4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC430655 | TMPRSS4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC432994 | TMPRSS4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY405242 | Transient overexpression lysate of transmembrane protease, serine 4 (TMPRSS4), transcript variant 2 |
USD 325.00 |
|
LY412678 | Transient overexpression lysate of transmembrane protease, serine 4 (TMPRSS4), transcript variant 1 |
USD 325.00 |
|
LY430655 | Transient overexpression lysate of transmembrane protease, serine 4 (TMPRSS4), transcript variant 2 |
USD 325.00 |
|
LY432994 | Transient overexpression lysate of transmembrane protease, serine 4 (TMPRSS4), transcript variant 5 |
USD 325.00 |
|
PH302384 | TMPRSS4 MS Standard C13 and N15-labeled recombinant protein (NP_899070) |
USD 2,055.00 |
|
PH303972 | TMPRSS4 MS Standard C13 and N15-labeled recombinant protein (NP_063947) |
USD 2,055.00 |
|
TP302384 | Recombinant protein of human transmembrane protease, serine 4 (TMPRSS4), transcript variant 2 |
USD 823.00 |
|
TP303972 | Recombinant protein of human transmembrane protease, serine 4 (TMPRSS4), transcript variant 1 |
USD 748.00 |
|
TP324725 | Purified recombinant protein of Homo sapiens transmembrane protease, serine 4 (TMPRSS4), transcript variant 3 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review