Nucleoside Diphosphate Kinase 7 (NME7) (NM_197972) Human Mass Spec Standard
CAT#: PH302669
NME7 MS Standard C13 and N15-labeled recombinant protein (NP_932076)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202669 |
Predicted MW | 42.5 kDa |
Protein Sequence |
>RC202669 protein sequence
Red=Cloning site Green=Tags(s) MNHSERFVFIAEWYDPNASLLRRYELLFYPGDGSVEMHDVKNHRTFLKRTKYDNLHLEDLFIGNKVNVFS RQLVLIDYGDQYTARQLGSRKEKTLALIKPDAISKAGEIIEIINKAGFTITKLKMMMLSRKEALDFHVDH QSRPFFNELIQFITTGPIIAMEILRDDAICEWKRLLGPANSGVARTDASESIRALFGTDGIRNAAHGPDS FASAAREMELFFPSSGGCGPANTAKFTNCTCCIVKPHAVSEGLLGKILMAIRDAGFEISAMQMFNMDRVN VEEFYEVYKGVVTEYHDMVTEMYSGPCVAMEIQQNNATKTFREFCGPADPEIARHLRPGTLRAIFGKTKI QNAVHCTDLPEDGLLEVQYFFKILDN myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_932076 |
RefSeq Size | 1625 |
RefSeq ORF | 1131 |
Synonyms | CFAP67; MN23H7; NDK 7; NDK7; nm23-H7 |
Locus ID | 29922 |
UniProt ID | Q9Y5B8, A0A024R8Z7 |
Cytogenetics | 1q24.2 |
Summary | This gene encodes a member of the non-metastatic expressed family of nucleoside diphosphate kinases. Members of this family are enzymes that catalyzes phosphate transfer from nucleoside triphosphates to nucleoside diphosphates. This protein contains two kinase domains, one of which is involved in autophosphorylation and the other may be inactive. This protein localizes to the centrosome and functions as a component of the gamma-tubulin ring complex which plays a role in microtubule organization. Mutations in this gene may be associated with venous thromboembolism. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Sep 2016] |
Protein Families | Druggable Genome |
Protein Pathways | Metabolic pathways, Purine metabolism, Pyrimidine metabolism |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405095 | NME7 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY405095 | Transient overexpression lysate of non-metastatic cells 7, protein expressed in (nucleoside-diphosphate kinase) (NME7), transcript variant 2 |
USD 396.00 |
|
TP302669 | Recombinant protein of human non-metastatic cells 7, protein expressed in (nucleoside-diphosphate kinase) (NME7), transcript variant 2 |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review