Germany
Japan
United Kingdom
China
Creatine kinase M type (CKM) (NM_001824) Human Mass Spec Standard
CAT#: PH302721
CKM MS Standard C13 and N15-labeled recombinant protein (NP_001815)
Product Images
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC202721 |
| Predicted MW | 43.1 kDa |
| Protein Sequence |
>RC202721 protein sequence
Red=Cloning site Green=Tags(s) MPFGNTHNKFKLNYKPEEEYPDLSKHNNHMAKVLTLELYKKLRDKETPSGFTVDDVIQTGVDNPGHPFIM TVGCVAGDEESYEVFKELFDPIISDRHGGYKPTDKHKTDLNHENLKGGDDLDPNYVLSSRVRTGRSIKGY TLPPHCSRGERRAVEKLSVEALNSLTGEFKGKYYPLKSMTEKEQQQLIDDHFLFDKPVSPLLLASGMARD WPDARGIWHNDNKSLLVWVNEEDHLRVISMEKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNQHLGYV LTCPSNLGTGLRGGVHVKLAHLSKHPKFEEILTRLRLQKRGTGGVDTAAVGSVFDVSNADRLGSSEVEQV QLVVDGVKLMVEMEKKLEKGQSIDDMIPAQK myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_001815 |
| RefSeq Size | 1666 |
| RefSeq ORF | 1143 |
| Synonyms | CKMM; CPK-M; M-CK |
| Locus ID | 1158 |
| UniProt ID | P06732, B2R892 |
| Cytogenetics | 19q13.32 |
| Summary | 'The protein encoded by this gene is a cytoplasmic enzyme involved in energy homeostasis and is an important serum marker for myocardial infarction. The encoded protein reversibly catalyzes the transfer of phosphate between ATP and various phosphogens such as creatine phosphate. It acts as a homodimer in striated muscle as well as in other tissues, and as a heterodimer with a similar brain isozyme in heart. The encoded protein is a member of the ATP:guanido phosphotransferase protein family. [provided by RefSeq, Jul 2008]' |
| Protein Families | Druggable Genome |
| Protein Pathways | Arginine and proline metabolism, Metabolic pathways |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400690 | CKM HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY400690 | Transient overexpression lysate of creatine kinase, muscle (CKM) |
USD 396.00 |
|
| TP302721 | Recombinant protein of human creatine kinase, muscle (CKM) |
USD 823.00 |
|
| TP721121 | Purified recombinant protein of Human creatine kinase, muscle (CKM) |
USD 330.00 |
|
| TP750145 | Purified recombinant heterodimer protein of Human CKMB(full length creatine kinase, muscle (CKM) with N-terminal GST tag, and full length creatine kinase, brain (CKB), with N-terminal His(CKB) tag), expressed in E.coli, 100ug |
USD 299.00 |
{0} Product Review(s)
Be the first one to submit a review