FGL1 (NM_201553) Human Mass Spec Standard

CAT#: PH302778

FGL1 MS Standard C13 and N15-labeled recombinant protein (NP_963847)

Product Images

Coomassie blue staining of purified FGL1 protein (Cat# TP302778). The protein was produced from HEK293T cells transfected with FGL1 cDNA clone (Cat# RC202778) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202778
• Predicted MW: 36.4 kDa
• Protein Sequence:
  Sequence Link

  >RC202778 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAKVFSFILVTTALTMGREISALEDCAQEQMRLRAQVRLLETRVKQQQVKIKQLLQENEVQFLDKGDENT
  VIDLGSKRQYADCSEIFNDGYKLSGFYKIKPLQSPAEFSVYCDMSDGGGWTVIQRRSDGSENFNRGWKDY
  ENGFGNFVQKHGEYWLGNKNLHFLTTQEDYTLKIDLADFEKNSRYAQYKNFKVGDEKNFYELNIGEYSGT
  AGDSLAGNFHPEVQWWASHQRMKFSTWDRDHDNYEGNCAEEDQSGWWFNRCHSANLNGVYYSGPYTAKTD
  NGIVWYTWHGWWYSLKSVVMKIRPNDFIPNVI
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_963847
• RefSeq Size: 1500
• RefSeq ORF: 936
• Synonyms: HFREP1; HP-041; HPS; LFIRE-1; LFIRE1
• Locus ID: 2267
• UniProt ID: Q08830
• Cytogenetics: 8p22
• Summary: 'Fibrinogen-like 1 is a member of the fibrinogen family. This protein is homologous to the carboxy terminus of the fibrinogen beta- and gamma- subunits which contains the four conserved cysteines of fibrinogens and fibrinogen related proteins. However, this protein lacks the platelet-binding site, cross-linking region and a thrombin-sensitive site which are necessary for fibrin clot formation. This protein may play a role in the development of hepatocellular carcinomas. Four alternatively spliced transcript variants encoding the same protein exist for this gene. [provided by RefSeq, Jul 2008]'
• Protein Families: Druggable Genome, Secreted Protein