FGL1 (NM_004467) Human Recombinant Protein
CAT#: TP312499
Recombinant protein of human fibrinogen-like 1 (FGL1), transcript variant 1
View other "FGL1" proteins (17)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC212499 protein sequence
Red=Cloning site Green=Tags(s) MAKVFSFILVTTALTMGREISALEDCAQEQMRLRAQVRLLETRVKQQQVKIKQLLQENEVQFLDKGDENT VIDLGSKRQYADCSEIFNDGYKLSGFYKIKPLQSPAEFSVYCDMSDGGGWTVIQRRSDGSENFNRGWKDY ENGFGNFVQKHGEYWLGNKNLHFLTTQEDYTLKIDLADFEKNSRYAQYKNFKVGDEKNFYELNIGEYSGT AGDSLAGNFHPEVQWWASHQRMKFSTWDRDHDNYEGNCAEEDQSGWWFNRCHSANLNGVYYSGPYTAKTD NGIVWYTWHGWWYSLKSVVMKIRPNDFIPNVI myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 34 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_004458 |
Locus ID | 2267 |
UniProt ID | Q08830 |
Cytogenetics | 8p22 |
Refseq Size | 1285 |
Refseq ORF | 936 |
Synonyms | HFREP1; HP-041; HPS; LFIRE-1; LFIRE1 |
Summary | Fibrinogen-like 1 is a member of the fibrinogen family. This protein is homologous to the carboxy terminus of the fibrinogen beta- and gamma- subunits which contains the four conserved cysteines of fibrinogens and fibrinogen related proteins. However, this protein lacks the platelet-binding site, cross-linking region and a thrombin-sensitive site which are necessary for fibrin clot formation. This protein may play a role in the development of hepatocellular carcinomas. Four alternatively spliced transcript variants encoding the same protein exist for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Secreted Protein |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404456 | FGL1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC404457 | FGL1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC407794 | FGL1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC417967 | FGL1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC430179 | FGL1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC430875 | FGL1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC430876 | FGL1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY404456 | Transient overexpression lysate of fibrinogen-like 1 (FGL1), transcript variant 3 |
USD 396.00 |
|
LY404457 | Transient overexpression lysate of fibrinogen-like 1 (FGL1), transcript variant 4 |
USD 396.00 |
|
LY407794 | Transient overexpression lysate of fibrinogen-like 1 (FGL1), transcript variant 2 |
USD 396.00 |
|
LY417967 | Transient overexpression lysate of fibrinogen-like 1 (FGL1), transcript variant 1 |
USD 396.00 |
|
LY430179 | Transient overexpression lysate of fibrinogen-like 1 (FGL1), transcript variant 2 |
USD 396.00 |
|
LY430875 | Transient overexpression lysate of fibrinogen-like 1 (FGL1), transcript variant 3 |
USD 396.00 |
|
LY430876 | Transient overexpression lysate of fibrinogen-like 1 (FGL1), transcript variant 4 |
USD 396.00 |
|
PH302778 | FGL1 MS Standard C13 and N15-labeled recombinant protein (NP_963847) |
USD 2,055.00 |
|
PH312499 | FGL1 MS Standard C13 and N15-labeled recombinant protein (NP_004458) |
USD 2,055.00 |
|
TP302778 | Purified recombinant protein of Homo sapiens fibrinogen-like 1 (FGL1), transcript variant 4 |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review