GMF beta (GMFB) (NM_004124) Human Mass Spec Standard

CAT#: PH302782

GMFB MS Standard C13 and N15-labeled recombinant protein (NP_004115)

Product Images

Coomassie blue staining of purified GMFB protein (Cat# TP302782). The protein was produced from HEK293T cells transfected with GMFB cDNA clone (Cat# RC202782) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202782
• Predicted MW: 18.1 kDa
• Protein Sequence:
  Sequence Link

  >RC202782 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKDELPERQPRFIV
  YSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLTEEWLREKLGF
  FTNVNFCVSKVFMY
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_004115
• RefSeq Size: 4125
• RefSeq ORF: 681
• Synonyms: GMF
• Locus ID: 2764
• UniProt ID: P60983
• Cytogenetics: 14q22.2
• Summary: ''