GMF beta (GMFB) (NM_004124) Human Recombinant Protein
CAT#: TP723145
Purified recombinant protein of Human glia maturation factor, beta (GMFB).
Product Images
![](https://cdn.origene.com/img/defaults-img.jpg)
Specifications
Product Data | |
Species | Human |
Expression Host | E. coli |
Expression cDNA Clone or AA Sequence |
SESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKDELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLTEEWLREKLGFFH
|
Tag | Tag Free |
Predicted MW | 16.5 kDa |
Concentration | Resuspend the protein in the desired concentration in proper buffer |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_004115 |
Locus ID | 2764 |
UniProt ID | P60983 |
Cytogenetics | 14q22.2 |
Refseq Size | 4125 |
Refseq ORF | 681 |
Synonyms | GMF |
Summary | '' |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418199 | GMFB HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY418199 | Transient overexpression lysate of glia maturation factor, beta (GMFB) |
USD 396.00 |
|
PH302782 | GMFB MS Standard C13 and N15-labeled recombinant protein (NP_004115) |
USD 2,055.00 |
|
TP302782 | Recombinant protein of human glia maturation factor, beta (GMFB) |
USD 823.00 |
|
TP721208 | Purified recombinant protein of Human glia maturation factor, beta (GMFB) |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review