GMF beta (GMFB) (NM_004124) Human Recombinant Protein

CAT#: TP302782

Recombinant protein of human glia maturation factor, beta (GMFB)

Product Images

Coomassie blue staining of purified GMFB protein (Cat# TP302782). The protein was produced from HEK293T cells transfected with GMFB cDNA clone (Cat# RC202782) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC202782 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKDELPERQPRFIV
  YSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLTEEWLREKLGF
  FTNVNFCVSKVFMY
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 16.5 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_004115
• Locus ID: 2764
• UniProt ID: P60983
• Cytogenetics: 14q22.2
• Refseq Size: 4125
• Refseq ORF: 462
• Synonyms: GMF
• Summary: This protein causes differentiation of brain cells, stimulation of neural regeneration, and inhibition of proliferation of tumor cells.[UniProtKB/Swiss-Prot Function]