C4BPB (NM_001017365) Human Mass Spec Standard

CAT#: PH302799

C4BPB MS Standard C13 and N15-labeled recombinant protein (NP_001017365)

Product Images

Coomassie blue staining of purified C4BPB protein (Cat# TP302799). The protein was produced from HEK293T cells transfected with C4BPB cDNA clone (Cat# RC202799) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202799
• Predicted MW: 28.3 kDa
• Protein Sequence:
  Sequence Link

  >RC202799 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MFFWCACCLMVAWRVSASDEHCPELPPVDNSIFVAKEVEGQILGTYVCIKGYHLVGKKTLFCNASKEWDN
  TTTECRLGHCPDPVLVNGEFSSSGPVNVSDKITFMCNDHYILKGSNRSQCLEDHTWAPPFPICKSRDCDP
  PGNPVHGYFEGNNFTLGSTISYYCEDRYYLVGVQEQQCVDGEWSSALPVCKLIQEAPKPECEKALLAFQE
  SKNLCEAMENFMQQLKESGMTMEELKYSLELKKAELKAKLL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001017365
• RefSeq Size: 968
• RefSeq ORF: 459
• Synonyms: C4BP
• Locus ID: 725
• UniProt ID: P20851
• Cytogenetics: 1q32.1
• Summary: This gene encodes a member of a superfamily of proteins composed predominantly of tandemly arrayed short consensus repeats of approximately 60 amino acids. A single, unique beta-chain encoded by this gene assembles with seven identical alpha-chains into the predominant isoform of C4b-binding protein, a multimeric protein that controls activation of the complement cascade through the classical pathway. C4b-binding protein has a regulatory role in the coagulation system also, mediated through the beta-chain binding of protein S, a vitamin K-dependent protein that serves as a cofactor of activated protein C. The genes encoding both alpha and beta chains are located adjacent to each other on human chromosome 1 in the regulator of complement activation gene cluster. Alternative splicing gives rise to multiple transcript variants. [provided by RefSeq, Jul 2008]
• Protein Pathways: Complement and coagulation cascades