C4BPB (NM_001017365) Human Recombinant Protein
CAT#: TP302799
Recombinant protein of human complement component 4 binding protein, beta (C4BPB), transcript variant 3
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202799 protein sequence
Red=Cloning site Green=Tags(s) MFFWCACCLMVAWRVSASDEHCPELPPVDNSIFVAKEVEGQILGTYVCIKGYHLVGKKTLFCNASKEWDN TTTECRLGHCPDPVLVNGEFSSSGPVNVSDKITFMCNDHYILKGSNRSQCLEDHTWAPPFPICKSRDCDP PGNPVHGYFEGNNFTLGSTISYYCEDRYYLVGVQEQQCVDGEWSSALPVCKLIQEAPKPECEKALLAFQE SKNLCEAMENFMQQLKESGMTMEELKYSLELKKAELKAKLL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 26.3 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001017365 |
Locus ID | 725 |
UniProt ID | P20851 |
Cytogenetics | 1q32.1 |
Refseq Size | 968 |
Refseq ORF | 459 |
Synonyms | C4BP |
Summary | This gene encodes a member of a superfamily of proteins composed predominantly of tandemly arrayed short consensus repeats of approximately 60 amino acids. A single, unique beta-chain encoded by this gene assembles with seven identical alpha-chains into the predominant isoform of C4b-binding protein, a multimeric protein that controls activation of the complement cascade through the classical pathway. C4b-binding protein has a regulatory role in the coagulation system also, mediated through the beta-chain binding of protein S, a vitamin K-dependent protein that serves as a cofactor of activated protein C. The genes encoding both alpha and beta chains are located adjacent to each other on human chromosome 1 in the regulator of complement activation gene cluster. Alternative splicing gives rise to multiple transcript variants. [provided by RefSeq, Jul 2008] |
Protein Pathways | Complement and coagulation cascades |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC422638 | C4BPB HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC422639 | C4BPB HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC422641 | C4BPB HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC424545 | C4BPB HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC425394 | C4BPB HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC425395 | C4BPB HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC425397 | C4BPB HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY422638 | Transient overexpression lysate of complement component 4 binding protein, beta (C4BPB), transcript variant 2 |
USD 325.00 |
|
LY422639 | Transient overexpression lysate of complement component 4 binding protein, beta (C4BPB), transcript variant 3 |
USD 325.00 |
|
LY422641 | Transient overexpression lysate of complement component 4 binding protein, beta (C4BPB), transcript variant 5 |
USD 325.00 |
|
LY424545 | Transient overexpression lysate of complement component 4 binding protein, beta (C4BPB), transcript variant 1 |
USD 325.00 |
|
LY425394 | Transient overexpression lysate of complement component 4 binding protein, beta (C4BPB), transcript variant 2 |
USD 325.00 |
|
LY425395 | Transient overexpression lysate of complement component 4 binding protein, beta (C4BPB), transcript variant 3 |
USD 325.00 |
|
LY425397 | Transient overexpression lysate of complement component 4 binding protein, beta (C4BPB), transcript variant 5 |
USD 325.00 |
|
PH302799 | C4BPB MS Standard C13 and N15-labeled recombinant protein (NP_001017365) |
USD 2,055.00 |
|
PH319158 | C4BPB MS Standard C13 and N15-labeled recombinant protein (NP_001017364) |
USD 2,055.00 |
|
PH319216 | C4BPB MS Standard C13 and N15-labeled recombinant protein (NP_001017367) |
USD 2,055.00 |
|
PH323685 | C4BPB MS Standard C13 and N15-labeled recombinant protein (NP_000707) |
USD 2,055.00 |
|
TP319158 | Recombinant protein of human complement component 4 binding protein, beta (C4BPB), transcript variant 2 |
USD 748.00 |
|
TP319216 | Purified recombinant protein of Homo sapiens complement component 4 binding protein, beta (C4BPB), transcript variant 5 |
USD 748.00 |
|
TP323685 | Recombinant protein of human complement component 4 binding protein, beta (C4BPB), transcript variant 1 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review