THG1L (NM_017872) Human Mass Spec Standard

CAT#: PH302845

THG1L MS Standard C13 and N15-labeled recombinant protein (NP_060342)

Product Images

Coomassie blue staining of purified THG1L protein (Cat# TP302845). The protein was produced from HEK293T cells transfected with THG1L cDNA clone (Cat# RC202845) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202845
• Predicted MW: 34.8 kDa
• Protein Sequence:
  Sequence Link

  >RC202845 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MWGACKVKVHDSLATISITLRRYLRLGATMAKSKFEYVRDFEADDTCLAHCWVVVRLDGRNFHRFAEKHN
  FAKPNDSRALQLMTKCAQTVMEELEDIVIAYGQSDEYSFVFKRKTNWFKRRASKFMTHVASQFASSYVFY
  WRDYFEDQPLLYPPGFDGRVVVYPSNQTLKDYLSWRQADCHINNLYNTVFWALIQQSGLTPVQAQGRLQG
  TLAADKNEILFSEFNINYNNEPPMYRKGTVLIWQKVDEVMTKEIKLPTEMEGKKMAVTRTRTKPVPLHCD
  IIGDAFWKEHPEILDEDS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_060342
• RefSeq Size: 1320
• RefSeq ORF: 894
• Synonyms: hTHG1; ICF45; IHG-1
• Locus ID: 54974
• UniProt ID: Q9NWX6
• Cytogenetics: 5q33.3
• Summary: The protein encoded by this gene is a mitochondrial protein that is induced by high levels of glucose and is associated with diabetic nephropathy. The encoded protein appears to increase mitochondrial biogenesis, which could lead to renal fibrosis. Another function of this protein is that of a guanyltransferase, adding GMP to the 5' end of tRNA(His). Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2015]