THG1L (NM_017872) Human Recombinant Protein

CAT#: TP302845

Recombinant protein of human tRNA-histidine guanylyltransferase 1-like (S. cerevisiae) (THG1L)

Product Images

Coomassie blue staining of purified THG1L protein (Cat# TP302845). The protein was produced from HEK293T cells transfected with THG1L cDNA clone (Cat# RC202845) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC202845 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MWGACKVKVHDSLATISITLRRYLRLGATMAKSKFEYVRDFEADDTCLAHCWVVVRLDGRNFHRFAEKHN
  FAKPNDSRALQLMTKCAQTVMEELEDIVIAYGQSDEYSFVFKRKTNWFKRRASKFMTHVASQFASSYVFY
  WRDYFEDQPLLYPPGFDGRVVVYPSNQTLKDYLSWRQADCHINNLYNTVFWALIQQSGLTPVQAQGRLQG
  TLAADKNEILFSEFNINYNNEPPMYRKGTVLIWQKVDEVMTKEIKLPTEMEGKKMAVTRTRTKPVPLHCD
  IIGDAFWKEHPEILDEDS
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 34.7 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_060342
• Locus ID: 54974
• UniProt ID: Q9NWX6
• Cytogenetics: 5q33.3
• Refseq Size: 1320
• Refseq ORF: 894
• Synonyms: hTHG1; ICF45; IHG-1; IHG1; SCAR28; THG1
• Summary: The protein encoded by this gene is a mitochondrial protein that is induced by high levels of glucose and is associated with diabetic nephropathy. The encoded protein appears to increase mitochondrial biogenesis, which could lead to renal fibrosis. Another function of this protein is that of a guanyltransferase, adding GMP to the 5' end of tRNA(His). Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2015]