THG1L (NM_017872) Human Recombinant Protein
CAT#: TP302845
Recombinant protein of human tRNA-histidine guanylyltransferase 1-like (S. cerevisiae) (THG1L)
View other "THG1L" proteins (3)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202845 protein sequence
Red=Cloning site Green=Tags(s) MWGACKVKVHDSLATISITLRRYLRLGATMAKSKFEYVRDFEADDTCLAHCWVVVRLDGRNFHRFAEKHN FAKPNDSRALQLMTKCAQTVMEELEDIVIAYGQSDEYSFVFKRKTNWFKRRASKFMTHVASQFASSYVFY WRDYFEDQPLLYPPGFDGRVVVYPSNQTLKDYLSWRQADCHINNLYNTVFWALIQQSGLTPVQAQGRLQG TLAADKNEILFSEFNINYNNEPPMYRKGTVLIWQKVDEVMTKEIKLPTEMEGKKMAVTRTRTKPVPLHCD IIGDAFWKEHPEILDEDS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 34.7 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_060342 |
Locus ID | 54974 |
UniProt ID | Q9NWX6 |
Cytogenetics | 5q33.3 |
Refseq Size | 1320 |
Refseq ORF | 894 |
Synonyms | hTHG1; ICF45; IHG-1; IHG1; SCAR28; THG1 |
Summary | The protein encoded by this gene is a mitochondrial protein that is induced by high levels of glucose and is associated with diabetic nephropathy. The encoded protein appears to increase mitochondrial biogenesis, which could lead to renal fibrosis. Another function of this protein is that of a guanyltransferase, adding GMP to the 5' end of tRNA(His). Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2015] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413494 | THG1L HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY413494 | Transient overexpression lysate of tRNA-histidine guanylyltransferase 1-like (S. cerevisiae) (THG1L) |
USD 396.00 |
|
PH302845 | THG1L MS Standard C13 and N15-labeled recombinant protein (NP_060342) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review