cvHSP (HSPB7) (NM_014424) Human Mass Spec Standard

CAT#: PH302861

HSPB7 MS Standard C13 and N15-labeled recombinant protein (NP_055239)

Product Images

Coomassie blue staining of purified HSPB7 protein (Cat# TP302861). The protein was produced from HEK293T cells transfected with HSPB7 cDNA clone (Cat# RC202861) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202861
• Predicted MW: 18.6 kDa
• Protein Sequence:
  Sequence Link

  >RC202861 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSHRTSSTFRAERSFHSSSSSSSSSTSSSASRALPAQDPPMEKALSMFSDDFGSFMRPHSEPLAFPARPG
  GAGNIKTLGDAYEFAVDVRDFSPEDIIVTTSNNHIEVRAEKLAADGTVMNTFAHKCQLPEDVDPTSVTSA
  LREDGSLTIRARRHPHTEHVQQTFRTEIKI
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_055239
• RefSeq Size: 2908
• RefSeq ORF: 510
• Synonyms: cvHSP
• Locus ID: 27129
• UniProt ID: Q9UBY9
• Cytogenetics: 1p36.13
• Summary: This gene encodes a small heat shock family B member that can heterodimerize with similar heat shock proteins. Defects in this gene are associated with advanced heart failure. In addition, the encoded protein may be a tumor suppressor in the p53 pathway, with defects in this gene being associated with renal cell carcinoma. [provided by RefSeq, Mar 2017]