cvHSP (HSPB7) (NM_014424) Human Recombinant Protein

CAT#: TP302861

Recombinant protein of human heat shock 27kDa protein family, member 7 (cardiovascular) (HSPB7)

Product Images

Coomassie blue staining of purified HSPB7 protein (Cat# TP302861). The protein was produced from HEK293T cells transfected with HSPB7 cDNA clone (Cat# RC202861) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC202861 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSHRTSSTFRAERSFHSSSSSSSSSTSSSASRALPAQDPPMEKALSMFSDDFGSFMRPHSEPLAFPARPG
  GAGNIKTLGDAYEFAVDVRDFSPEDIIVTTSNNHIEVRAEKLAADGTVMNTFAHKCQLPEDVDPTSVTSA
  LREDGSLTIRARRHPHTEHVQQTFRTEIKI
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 18.4 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_055239
• Locus ID: 27129
• UniProt ID: Q9UBY9
• Cytogenetics: 1p36.13
• Refseq Size: 2908
• Refseq ORF: 510
• Synonyms: cvHSP
• Summary: This gene encodes a small heat shock family B member that can heterodimerize with similar heat shock proteins. Defects in this gene are associated with advanced heart failure. In addition, the encoded protein may be a tumor suppressor in the p53 pathway, with defects in this gene being associated with renal cell carcinoma. [provided by RefSeq, Mar 2017]