NUDT22 (NM_032344) Human Mass Spec Standard

CAT#: PH302982

NUDT22 MS Standard C13 and N15-labeled recombinant protein (NP_115720)

Product Images

Coomassie blue staining of purified NUDT22 protein (Cat# TP302982). The protein was produced from HEK293T cells transfected with NUDT22 cDNA clone (Cat# RC202982) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202982
• Predicted MW: 32.6 kDa
• Protein Sequence:
  Sequence Link

  >RC202982 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MDPEVTLLLQCPGGGLPQEQIQAELSPAHDRRPLPGGDEAITAIWETRLKAQPWLFDAPKFRLHSATLAP
  IGSRGPQLLLRLGLTSYRDFLGTNWSSSAAWLRQQGATDWGDTQAYLADPLGVGAALATADDFLVFLRRS
  RQVAEAPGLVDVPGGHPEPQALCPGGSPQHQDLAGQLVVHELFSSVLQEICDEVNLPLLTLSQPLLLGIA
  RNETSAGRASAEFYVQCSLTSEQVRKHYLSGGPEAHESTGIFFVETQNVRRLPETEMWAELCPSAKGAII
  LYNRVQGSPTGAALGSPALLPPL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_115720
• RefSeq Size: 1141
• RefSeq ORF: 909
• Synonyms: MGC13045
• Locus ID: 84304
• UniProt ID: Q9BRQ3
• Cytogenetics: 11q13.1