NUDT22 (NM_032344) Human Recombinant Protein

CAT#: TP302982

Recombinant protein of human nudix (nucleoside diphosphate linked moiety X)-type motif 22 (NUDT22), transcript variant 1

Product Images

Coomassie blue staining of purified NUDT22 protein (Cat# TP302982). The protein was produced from HEK293T cells transfected with NUDT22 cDNA clone (Cat# RC202982) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC202982 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MDPEVTLLLQCPGGGLPQEQIQAELSPAHDRRPLPGGDEAITAIWETRLKAQPWLFDAPKFRLHSATLAP
  IGSRGPQLLLRLGLTSYRDFLGTNWSSSAAWLRQQGATDWGDTQAYLADPLGVGAALATADDFLVFLRRS
  RQVAEAPGLVDVPGGHPEPQALCPGGSPQHQDLAGQLVVHELFSSVLQEICDEVNLPLLTLSQPLLLGIA
  RNETSAGRASAEFYVQCSLTSEQVRKHYLSGGPEAHESTGIFFVETQNVRRLPETEMWAELCPSAKGAII
  LYNRVQGSPTGAALGSPALLPPL
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 32.4 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_115720
• Locus ID: 84304
• UniProt ID: Q9BRQ3
• Cytogenetics: 11q13.1
• Refseq Size: 1141
• Refseq ORF: 909
• Summary: Hydrolyzes UDP-glucose to glucose 1-phosphate and UMP and UDP-galactose to galactose 1-phosphate and UMP. Preferred substrate is UDP-glucose.[UniProtKB/Swiss-Prot Function]