PI3 (NM_002638) Human Mass Spec Standard
CAT#: PH303136
PI3 MS Standard C13 and N15-labeled recombinant protein (NP_002629)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203136 |
Predicted MW | 12.3 kDa |
Protein Sequence |
>RC203136 protein sequence
Red=Cloning site Green=Tags(s) MRASSFLIVVVFLIAGTLVLEAAVTGVPVKGQDTVKGRVPFNGQDPVKGQVSVKGQDKVKAQEPVKGPVS TKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_002629 |
RefSeq Size | 579 |
RefSeq ORF | 351 |
Synonyms | cementoin; ESI; SKALP; WAP3; WFDC14 |
Locus ID | 5266 |
UniProt ID | P19957 |
Cytogenetics | 20q13.12 |
Summary | 'This gene encodes an elastase-specific inhibitor that functions as an antimicrobial peptide against Gram-positive and Gram-negative bacteria, and fungal pathogens. The protein contains a WAP-type four-disulfide core (WFDC) domain, and is thus a member of the WFDC domain family. Most WFDC gene members are localized to chromosome 20q12-q13 in two clusters: centromeric and telomeric. This gene belongs to the centromeric cluster. Expression of this gene is upgulated by bacterial lipopolysaccharides and cytokines. [provided by RefSeq, Oct 2014]' |
Protein Families | Secreted Protein, Transmembrane |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400936 | PI3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY400936 | Transient overexpression lysate of peptidase inhibitor 3, skin-derived (PI3) |
USD 325.00 |
|
TP303136 | Recombinant protein of human peptidase inhibitor 3, skin-derived (PI3) |
USD 439.00 |
|
TP720751 | Purified recombinant protein of Human peptidase inhibitor 3, skin-derived (PI3) |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review