PI3 (NM_002638) Human Mass Spec Standard

CAT#: PH303136

PI3 MS Standard C13 and N15-labeled recombinant protein (NP_002629)

Product Images

Coomassie blue staining of purified PI3 protein (Cat# TP303136). The protein was produced from HEK293T cells transfected with PI3 cDNA clone (Cat# RC203136) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203136
• Predicted MW: 12.3 kDa
• Protein Sequence:
  Sequence Link

  >RC203136 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MRASSFLIVVVFLIAGTLVLEAAVTGVPVKGQDTVKGRVPFNGQDPVKGQVSVKGQDKVKAQEPVKGPVS
  TKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_002629
• RefSeq Size: 579
• RefSeq ORF: 351
• Synonyms: cementoin; ESI; SKALP; WAP3; WFDC14
• Locus ID: 5266
• UniProt ID: P19957
• Cytogenetics: 20q13.12
• Summary: 'This gene encodes an elastase-specific inhibitor that functions as an antimicrobial peptide against Gram-positive and Gram-negative bacteria, and fungal pathogens. The protein contains a WAP-type four-disulfide core (WFDC) domain, and is thus a member of the WFDC domain family. Most WFDC gene members are localized to chromosome 20q12-q13 in two clusters: centromeric and telomeric. This gene belongs to the centromeric cluster. Expression of this gene is upgulated by bacterial lipopolysaccharides and cytokines. [provided by RefSeq, Oct 2014]'
• Protein Families: Secreted Protein, Transmembrane