PI3 (NM_002638) Human Recombinant Protein

CAT#: TP303136

Recombinant protein of human peptidase inhibitor 3, skin-derived (PI3)

Product Images

Coomassie blue staining of purified PI3 protein (Cat# TP303136). The protein was produced from HEK293T cells transfected with PI3 cDNA clone (Cat# RC203136) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC203136 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MRASSFLIVVVFLIAGTLVLEAAVTGVPVKGQDTVKGRVPFNGQDPVKGQVSVKGQDKVKAQEPVKGPVS
  TKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 9.9 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_002629
• Locus ID: 5266
• UniProt ID: P19957
• Cytogenetics: 20q13.12
• Refseq Size: 579
• Refseq ORF: 351
• Synonyms: cementoin; ESI; SKALP; WAP3; WFDC14
• Summary: This gene encodes an elastase-specific inhibitor that functions as an antimicrobial peptide against Gram-positive and Gram-negative bacteria, and fungal pathogens. The protein contains a WAP-type four-disulfide core (WFDC) domain, and is thus a member of the WFDC domain family. Most WFDC gene members are localized to chromosome 20q12-q13 in two clusters: centromeric and telomeric. This gene belongs to the centromeric cluster. Expression of this gene is upgulated by bacterial lipopolysaccharides and cytokines. [provided by RefSeq, Oct 2014]
• Protein Families: Secreted Protein, Transmembrane