PI3 (NM_002638) Human Recombinant Protein

CAT#: TP720751

Purified recombinant protein of Human peptidase inhibitor 3, skin-derived (PI3)


  View other "PI3" proteins (4)

USD 300.00

2 Weeks*

Size
    • 10 ug

Product Images

Specifications

Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
AVTGVPVKGQDTVKGRVPFNGQDPVKGQVSVKGQDKVKAQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQVDHHHHHH
Tag C-His
Predicted MW 11 kDa
Purity >95% as determined by SDS-PAGE and Coomassie blue staining
Buffer Supplied as a 0.2 µM filtered solution of 20mM Tris-HCl, 150mM NaCl, pH 7.5
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
Storage Store at -80°C.
Stability Stable for at least 3 months from date of receipt under proper storage and handling conditions.
Reference Data
RefSeq NP_002629
Locus ID 5266
UniProt ID P19957
Cytogenetics 20q13.12
Refseq Size 579
Refseq ORF 351
Synonyms cementoin; ESI; SKALP; WAP3; WFDC14
Summary 'This gene encodes an elastase-specific inhibitor that functions as an antimicrobial peptide against Gram-positive and Gram-negative bacteria, and fungal pathogens. The protein contains a WAP-type four-disulfide core (WFDC) domain, and is thus a member of the WFDC domain family. Most WFDC gene members are localized to chromosome 20q12-q13 in two clusters: centromeric and telomeric. This gene belongs to the centromeric cluster. Expression of this gene is upgulated by bacterial lipopolysaccharides and cytokines. [provided by RefSeq, Oct 2014]'
Protein Families Secreted Protein, Transmembrane

Documents

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.