PI3 (NM_002638) Human Recombinant Protein
CAT#: TP720751
Purified recombinant protein of Human peptidase inhibitor 3, skin-derived (PI3)
Product Images
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence |
AVTGVPVKGQDTVKGRVPFNGQDPVKGQVSVKGQDKVKAQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQVDHHHHHH
|
Tag | C-His |
Predicted MW | 11 kDa |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Supplied as a 0.2 µM filtered solution of 20mM Tris-HCl, 150mM NaCl, pH 7.5 |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 3 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_002629 |
Locus ID | 5266 |
UniProt ID | P19957 |
Cytogenetics | 20q13.12 |
Refseq Size | 579 |
Refseq ORF | 351 |
Synonyms | cementoin; ESI; SKALP; WAP3; WFDC14 |
Summary | 'This gene encodes an elastase-specific inhibitor that functions as an antimicrobial peptide against Gram-positive and Gram-negative bacteria, and fungal pathogens. The protein contains a WAP-type four-disulfide core (WFDC) domain, and is thus a member of the WFDC domain family. Most WFDC gene members are localized to chromosome 20q12-q13 in two clusters: centromeric and telomeric. This gene belongs to the centromeric cluster. Expression of this gene is upgulated by bacterial lipopolysaccharides and cytokines. [provided by RefSeq, Oct 2014]' |
Protein Families | Secreted Protein, Transmembrane |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400936 | PI3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY400936 | Transient overexpression lysate of peptidase inhibitor 3, skin-derived (PI3) |
USD 325.00 |
|
PH303136 | PI3 MS Standard C13 and N15-labeled recombinant protein (NP_002629) |
USD 2,055.00 |
|
TP303136 | Recombinant protein of human peptidase inhibitor 3, skin-derived (PI3) |
USD 439.00 |
{0} Product Review(s)
Be the first one to submit a review