ZNF213 (NM_004220) Human Mass Spec Standard

CAT#: PH303547

ZNF213 MS Standard C13 and N15-labeled recombinant protein (NP_004211)

Product Images

Coomassie blue staining of purified ZNF213 protein (Cat# TP303547). The protein was produced from HEK293T cells transfected with ZNF213 cDNA clone (Cat# RC203547) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203547
• Predicted MW: 51.3 kDa
• Protein Sequence:
  Sequence Link

  >RC203547 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAAPLEAQDQAPGEGEGLLIVKVEDSSWEQESAQHEDGRDSEACRQRFRQFCYGDVHGPHEAFSQLWELC
  CRWLRPELRTKEQILELLVLEQFLTVLPGEIQGWVREQHPGSGEEAVALVEDLQKQPVKAWRQDVPSEEA
  EPEAAGRGSQATGPPPTVGARRRPSVPQEQHSHSAQPPALLKEGRPGETTDTCFVSGVHGPVALGDIPFY
  FSREEWGTLDPAQRDLFWDIKRENSRNTTLGFGLKGQSEKSLLQEMVPVVPGQTGSDVTVSWSPEEAEAW
  ESENRPRAALGPVVGARRGRPPTRRRQFRDLAAEKPHSCGQCGKRFRWGSDLARHQRTHTGEKPHKCPEC
  DKSFRSSSDLVRHQGVHTGEKPFSCSECGKSFSRSAYLADHQRIHTGEKPFGCSDCGKSFSLRSYLLDHR
  RVHTGERPFGCGECDKSFKQRAHLIAHQSLHAKMAQPVG
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_004211
• RefSeq Size: 3301
• RefSeq ORF: 1377
• Synonyms: CR53; ZKSCAN21; ZSCAN53
• Locus ID: 7760
• UniProt ID: O14771, A0A0S2Z4L6
• Cytogenetics: 16p13.3
• Summary: C2H2 zinc finger proteins, such as ZNF213, have bipartite structures in which one domain binds DNA or RNA and the other modulates target gene expression. [supplied by OMIM, Apr 2004]
• Protein Families: Transcription Factors