ZNF213 (NM_004220) Human Recombinant Protein

CAT#: TP303547

Recombinant protein of human zinc finger protein 213 (ZNF213), transcript variant 1

Product Images

Coomassie blue staining of purified ZNF213 protein (Cat# TP303547). The protein was produced from HEK293T cells transfected with ZNF213 cDNA clone (Cat# RC203547) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC203547 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAAPLEAQDQAPGEGEGLLIVKVEDSSWEQESAQHEDGRDSEACRQRFRQFCYGDVHGPHEAFSQLWELC
  CRWLRPELRTKEQILELLVLEQFLTVLPGEIQGWVREQHPGSGEEAVALVEDLQKQPVKAWRQDVPSEEA
  EPEAAGRGSQATGPPPTVGARRRPSVPQEQHSHSAQPPALLKEGRPGETTDTCFVSGVHGPVALGDIPFY
  FSREEWGTLDPAQRDLFWDIKRENSRNTTLGFGLKGQSEKSLLQEMVPVVPGQTGSDVTVSWSPEEAEAW
  ESENRPRAALGPVVGARRGRPPTRRRQFRDLAAEKPHSCGQCGKRFRWGSDLARHQRTHTGEKPHKCPEC
  DKSFRSSSDLVRHQGVHTGEKPFSCSECGKSFSRSAYLADHQRIHTGEKPFGCSDCGKSFSLRSYLLDHR
  RVHTGERPFGCGECDKSFKQRAHLIAHQSLHAKMAQPVG
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 51.1 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_004211
• Locus ID: 7760
• UniProt ID: O14771, A0A0S2Z4L6
• Cytogenetics: 16p13.3
• Refseq Size: 3301
• Refseq ORF: 1377
• Synonyms: CR53; ZKSCAN21; ZSCAN53
• Summary: C2H2 zinc finger proteins, such as ZNF213, have bipartite structures in which one domain binds DNA or RNA and the other modulates target gene expression.[supplied by OMIM, Apr 2004]
• Protein Families: Transcription Factors