ARF6 (NM_001663) Human Mass Spec Standard

CAT#: PH303600

ARF6 MS Standard C13 and N15-labeled recombinant protein (NP_001654)

Product Images

Coomassie blue staining of purified ARF6 protein (Cat# TP303600). The protein was produced from HEK293T cells transfected with ARF6 cDNA clone (Cat# RC203600) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203600
• Predicted MW: 20.1 kDa
• Protein Sequence:
  Sequence Link

  >RC203600 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGKVLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKI
  RPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLG
  LTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYKS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001654
• RefSeq Size: 3939
• RefSeq ORF: 525
• Synonyms: DKFZp564M0264
• Locus ID: 382
• UniProt ID: P62330
• Cytogenetics: 14q21.3
• Summary: 'This gene encodes a member of the human ARF gene family, which is part of the RAS superfamily. The ARF genes encode small guanine nucleotide-binding proteins that stimulate the ADP-ribosyltransferase activity of cholera toxin and play a role in vesicular trafficking and as activators of phospholipase D. The product of this gene is localized to the plasma membrane, and regulates vesicular trafficking, remodelling of membrane lipids, and signaling pathways that lead to actin remodeling. A pseudogene of this gene is located on chromosome 7. [provided by RefSeq, Jul 2008]'
• Protein Pathways: Endocytosis, Fc gamma R-mediated phagocytosis