ARF6 (NM_001663) Human Recombinant Protein
CAT#: TP303600
Recombinant protein of human ADP-ribosylation factor 6 (ARF6)
View other "ARF6" proteins (3)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203600 protein sequence
Red=Cloning site Green=Tags(s) MGKVLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKI RPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLG LTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYKS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 19.9 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001654 |
Locus ID | 382 |
UniProt ID | P62330 |
Cytogenetics | 14q21.3 |
Refseq Size | 3939 |
Refseq ORF | 525 |
Summary | This gene encodes a member of the human ARF gene family, which is part of the RAS superfamily. The ARF genes encode small guanine nucleotide-binding proteins that stimulate the ADP-ribosyltransferase activity of cholera toxin and play a role in vesicular trafficking and as activators of phospholipase D. The product of this gene is localized to the plasma membrane, and regulates vesicular trafficking, remodelling of membrane lipids, and signaling pathways that lead to actin remodeling. A pseudogene of this gene is located on chromosome 7. [provided by RefSeq, Jul 2008] |
Protein Pathways | Endocytosis, Fc gamma R-mediated phagocytosis |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400629 | ARF6 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY400629 | Transient overexpression lysate of ADP-ribosylation factor 6 (ARF6) |
USD 396.00 |
|
PH303600 | ARF6 MS Standard C13 and N15-labeled recombinant protein (NP_001654) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review