RXYLT1 (NM_014254) Human Mass Spec Standard

CAT#: PH303762

TMEM5 MS Standard C13 and N15-labeled recombinant protein (NP_055069)

Product Images

Coomassie blue staining of purified RXYLT1 protein (Cat# TP303762). The protein was produced from HEK293T cells transfected with RXYLT1 cDNA clone (Cat# RC203762) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203762
• Predicted MW: 51.1 kDa
• Protein Sequence:
  Sequence Link

  >RC203762 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MRLTRKRLCSFLIALYCLFSLYAAYHVFFGRRRQAPAGSPRGLRKGAAPARERRGREQSTLESEEWNPWE
  GDEKNEQQHRFKTSLQILDKSTKGKTDLSVQIWGKAAIGLYLWEHIFEGLLDPSDVTAQWREGKSIVGRT
  QYSFITGPAVIPGYFSVDVNNVVLILNGREKAKIFYATQWLLYAQNLVQIQKLQHLAVVLLGNEHCDNEW
  INPFLKRNGGFVELLFIIYDSPWINDVDVFQWPLGVATYRNFPVVEASWSMLHDERPYLCNFLGTIYENS
  SRQALMNILKKDGNDKLCWVSAREHWQPQETNESLKNYQDALLQSDLTLCPVGVNTECYRIYEACSYGSI
  PVVEDVMTAGNCGNTSVHHGAPLQLLKSMGAPFIFIKNWKELPAVLEKEKTIILQEKIERRKMLLQWYQH
  FKTELKMKFTNILESSFLMNNKS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_055069
• RefSeq Size: 1963
• RefSeq ORF: 1329
• Synonyms: HP10481; MDDGA10; TMEM5
• Locus ID: 10329
• UniProt ID: Q9Y2B1
• Cytogenetics: 12q14.2
• Summary: This gene encodes a type II transmembrane protein that is thought to have glycosyltransferase function. Mutations in this gene result in cobblestone lissencephaly. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, May 2013]
• Protein Families: Transmembrane