RXYLT1 (NM_014254) Human Recombinant Protein

CAT#: TP303762

Recombinant protein of human transmembrane protein 5 (TMEM5)

Product Images

TMEM5 is the UDP-Xyl transferase for alpha-DG-Fc340. Recombinant full-length TMEM5 (OriGene TP303762) and radiolabeled UDP-Xyl [Xyl-14C] was incubated with either purified alpha-DG-Fc340 or mutant alpha-DGFc340-T317A/T319A. Scintillation chromatography measured the incorporation of radioactivity into the proteins (N = 3). Figure cited from elife, PMID: 27130732

• 

  Coomassie blue staining of purified RXYLT1 protein (Cat# TP303762). The protein was produced from HEK293T cells transfected with RXYLT1 cDNA clone (Cat# RC203762) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC203762 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MRLTRKRLCSFLIALYCLFSLYAAYHVFFGRRRQAPAGSPRGLRKGAAPARERRGREQSTLESEEWNPWE
  GDEKNEQQHRFKTSLQILDKSTKGKTDLSVQIWGKAAIGLYLWEHIFEGLLDPSDVTAQWREGKSIVGRT
  QYSFITGPAVIPGYFSVDVNNVVLILNGREKAKIFYATQWLLYAQNLVQIQKLQHLAVVLLGNEHCDNEW
  INPFLKRNGGFVELLFIIYDSPWINDVDVFQWPLGVATYRNFPVVEASWSMLHDERPYLCNFLGTIYENS
  SRQALMNILKKDGNDKLCWVSAREHWQPQETNESLKNYQDALLQSDLTLCPVGVNTECYRIYEACSYGSI
  PVVEDVMTAGNCGNTSVHHGAPLQLLKSMGAPFIFIKNWKELPAVLEKEKTIILQEKIERRKMLLQWYQH
  FKTELKMKFTNILESSFLMNNKS
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 51 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Bioactivity: Enzyme activity (PMID: 27130732)
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_055069
• Locus ID: 10329
• UniProt ID: Q9Y2B1
• Cytogenetics: 12q14.2
• Refseq Size: 1963
• Refseq ORF: 1329
• Synonyms: HP10481; MDDGA10; TMEM5
• Summary: This gene encodes a type II transmembrane protein that is thought to have glycosyltransferase function. Mutations in this gene result in cobblestone lissencephaly. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, May 2013]
• Protein Families: Transmembrane