Papillary renal cell carcinoma (PRCC) (NM_005973) Human Mass Spec Standard

CAT#: PH303805

PRCC MS Standard C13 and N15-labeled recombinant protein (NP_005964)

Product Images

Coomassie blue staining of purified PRCC protein (Cat# TP303805). The protein was produced from HEK293T cells transfected with PRCC cDNA clone (Cat# RC203805) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203805
• Predicted MW: 52.4 kDa
• Protein Sequence:
  Sequence Link

  >RC203805 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSLVAYASSDESEPDEAEPEPEEEEAVAPTSGPALGGLFASLPAPKGPALLPPPPQMLAPAFPPPLLLPP
  PTGDPRLQPPPPLPFGLGGFPPPPGVSPAEAAGVGEGLGLGLPSPRGPGLNLPPPIGGAGPPLGLPKPKK
  RKEPVKIAAPELHKGDSDSEEDEPTKKKTILQGSSEGTGLSALLPQPKNLTVKETNRLLLPHAFSRKPSD
  GSPDTKPSRLASKTKTSSLAPVVGTTTTTPSPSAIKAAAKSAALQVTKQITQEEDDSDEEVAPENFFSLP
  EKAEPPGVEPYPYPIPTVPEELPPGTEPEPAFQDDAANAPLEFKMAAGSSGAPWMPKPGDDYSYNQFSTY
  GDANAAGAYYQDYYSGGYYPAQDPALVPTQEIAPDASFIDDEAFKRLQGKRNRGREEINFVEIKGDDQLS
  GAQQWMTKSLTEEKTMKSFSKKKGEQPTGQQRRKHQITYLIHQAKERELELKNTWSENKLSRRQTQAKYG
  F
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_005964
• RefSeq Size: 2142
• RefSeq ORF: 1473
• Synonyms: RCCP1; TPRC
• Locus ID: 5546
• UniProt ID: Q92733, A0A0S2Z456, Q96FT4
• Cytogenetics: 1q23.1
• Summary: 'This gene encodes a protein that may play a role in pre-mRNA splicing. Chromosomal translocations (X;1)(p11;q21) that result in fusion of this gene to TFE3 (GeneID 7030) have been associated with papillary renal cell carcinoma. A PRCC-TFE3 fusion protein is expressed in affected carcinomas and is likely associated with altered gene transactivation. This fusion protein has also been associated with disruption of the cell cycle.[provided by RefSeq, Aug 2010]'
• Protein Families: Druggable Genome