Papillary renal cell carcinoma (PRCC) (NM_005973) Human Recombinant Protein

CAT#: TP303805

Recombinant protein of human papillary renal cell carcinoma (translocation-associated) (PRCC), transcript variant 1

Product Images

Coomassie blue staining of purified PRCC protein (Cat# TP303805). The protein was produced from HEK293T cells transfected with PRCC cDNA clone (Cat# RC203805) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC203805 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSLVAYASSDESEPDEAEPEPEEEEAVAPTSGPALGGLFASLPAPKGPALLPPPPQMLAPAFPPPLLLPP
  PTGDPRLQPPPPLPFGLGGFPPPPGVSPAEAAGVGEGLGLGLPSPRGPGLNLPPPIGGAGPPLGLPKPKK
  RKEPVKIAAPELHKGDSDSEEDEPTKKKTILQGSSEGTGLSALLPQPKNLTVKETNRLLLPHAFSRKPSD
  GSPDTKPSRLASKTKTSSLAPVVGTTTTTPSPSAIKAAAKSAALQVTKQITQEEDDSDEEVAPENFFSLP
  EKAEPPGVEPYPYPIPTVPEELPPGTEPEPAFQDDAANAPLEFKMAAGSSGAPWMPKPGDDYSYNQFSTY
  GDANAAGAYYQDYYSGGYYPAQDPALVPTQEIAPDASFIDDEAFKRLQGKRNRGREEINFVEIKGDDQLS
  GAQQWMTKSLTEEKTMKSFSKKKGEQPTGQQRRKHQITYLIHQAKERELELKNTWSENKLSRRQTQAKYG
  F
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 52.2 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_005964
• Locus ID: 5546
• UniProt ID: Q92733, A0A0S2Z456, Q96FT4
• Cytogenetics: 1q23.1
• Refseq Size: 2142
• Refseq ORF: 1473
• Synonyms: RCCP1; TPRC
• Summary: This gene encodes a protein that may play a role in pre-mRNA splicing. Chromosomal translocations (X;1)(p11;q21) that result in fusion of this gene to TFE3 (GeneID 7030) have been associated with papillary renal cell carcinoma. A PRCC-TFE3 fusion protein is expressed in affected carcinomas and is likely associated with altered gene transactivation. This fusion protein has also been associated with disruption of the cell cycle.[provided by RefSeq, Aug 2010]
• Protein Families: Druggable Genome