PERP (NM_022121) Human Mass Spec Standard

CAT#: PH304012

PERP MS Standard C13 and N15-labeled recombinant protein (NP_071404)

Product Images

Coomassie blue staining of purified PERP protein (Cat# TP304012). The protein was produced from HEK293T cells transfected with PERP cDNA clone (Cat# RC204012) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204012
• Predicted MW: 21.4 kDa
• Protein Sequence:
  Sequence Link

  >RC204012 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MIRCGLACERCRWILPLLLLSAIAFDIIALAGRGWLQSSDHGQTSSLWWKCSQEGGGSGSYEEGCQSLME
  YAWGRAAAAMLFCGFIILVICFILSFFALCGPQMLVFLRVIGGLLALAAVFQIISLVIYPVKYTQTFTLH
  ANPAVTYIYNWAYGFGWAATIILIGCAFFFCCLPNYEDDLLGNAKPRYFYTSA
  
  SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_071404
• RefSeq Size: 4319
• RefSeq ORF: 579
• Synonyms: dJ496H19.1; KCP1; KRTCAP1; PIGPC1; THW
• Locus ID: 64065
• UniProt ID: Q96FX8
• Cytogenetics: 6q23.3
• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: p53 signaling pathway