PERP (NM_022121) Human Recombinant Protein

CAT#: TP304012

Recombinant protein of human PERP, TP53 apoptosis effector (PERP)

Product Images

Coomassie blue staining of purified PERP protein (Cat# TP304012). The protein was produced from HEK293T cells transfected with PERP cDNA clone (Cat# RC204012) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >Peptide sequence encoded by RC204012
  Blue=ORF Red=Cloning site Green=Tag(s)
  
  MIRCGLACERCRWILPLLLLSAIAFDIIALAGRGWLQSSDHGQTSSLWWKCSQEGGGSGSYEEGCQSLM
  EYAWGRAAAAMLFCGFIILVICFILSFFALCGPQMLVFLRVIGGLLALAAVFQIISLVIYPVKYTQTFT
  LHANPAVTYIYNWAYGFGWAATIILIGCAFFFCCLPNYEDDLLGNAKPRYFYTSA
  SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
  
  Recombinant protein using RC204012 also available, TP304012M
• Tag: C-Myc/DDK
• Predicted MW: 21.2 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_071404
• Locus ID: 64065
• UniProt ID: Q96FX8
• Cytogenetics: 6q23.3
• Refseq Size: 4319
• Refseq ORF: 579
• Synonyms: dJ496H19.1; KCP1; KRTCAP1; PIGPC1; THW
• Summary: Component of intercellular desmosome junctions. Plays a role in stratified epithelial integrity and cell-cell adhesion by promoting desmosome assembly. Plays a role as an effector in the TP53-dependent apoptotic pathway (By similarity).[UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: p53 signaling pathway