ID4 (NM_001546) Human Mass Spec Standard

CAT#: PH304170

ID4 MS Standard C13 and N15-labeled recombinant protein (NP_001537)

Product Images

Coomassie blue staining of purified ID4 protein (Cat# TP304170). The protein was produced from HEK293T cells transfected with ID4 cDNA clone (Cat# RC204170) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204170
• Predicted MW: 16.4 kDa
• Protein Sequence:
  Sequence Link

  >RC204170 representing NM_001546
  Red=Cloning site Green=Tags(s)
  
  MKAVSPVRPSGRKAPSGCGGGELALRCLAEHGHSLGGSAAAAAAAAAARCKAAEAAADEPALCLQCDMND
  CYSRLRRLVPTIPPNKKVSKVEILQHVIDYILDLQLALETHPALLRQPPPPAPPHHPAGTCPAAPPRTPL
  TALNTDPAGAVNKQGDSILCR
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001537
• RefSeq Size: 2389
• RefSeq ORF: 483
• Synonyms: bHLHb27; IDB4
• Locus ID: 3400
• UniProt ID: P47928
• Cytogenetics: 6p22.3
• Summary: 'This gene encodes a member of the inhibitor of DNA binding (ID) protein family. The encoded protein lacks DNA binding ability, and instead regulates gene expression through binding to and inhibiting basic helix-loop-helix transcription factors. This protein has been implicated in the regulation of diverse cellular processes that play a role in development and tumorigenesis. [provided by RefSeq, Aug 2017]'
• Protein Families: ES Cell Differentiation/IPS, Transcription Factors
• Protein Pathways: TGF-beta signaling pathway