ID4 (NM_001546) Human Recombinant Protein

CAT#: TP304170

Recombinant protein of human inhibitor of DNA binding 4, dominant negative helix-loop-helix protein (ID4)

Product Images

Coomassie blue staining of purified ID4 protein (Cat# TP304170). The protein was produced from HEK293T cells transfected with ID4 cDNA clone (Cat# RC204170) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC204170 representing NM_001546
  Red=Cloning site Green=Tags(s)
  
  MKAVSPVRPSGRKAPSGCGGGELALRCLAEHGHSLGGSAAAAAAAAAARCKAAEAAADEPALCLQCDMND
  CYSRLRRLVPTIPPNKKVSKVEILQHVIDYILDLQLALETHPALLRQPPPPAPPHHPAGTCPAAPPRTPL
  TALNTDPAGAVNKQGDSILCR
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 16.4 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001537
• Locus ID: 3400
• UniProt ID: P47928
• Cytogenetics: 6p22.3
• Refseq Size: 2389
• Refseq ORF: 483
• Synonyms: bHLHb27; IDB4
• Summary: This gene encodes a member of the inhibitor of DNA binding (ID) protein family. The encoded protein lacks DNA binding ability, and instead regulates gene expression through binding to and inhibiting basic helix-loop-helix transcription factors. This protein has been implicated in the regulation of diverse cellular processes that play a role in development and tumorigenesis. [provided by RefSeq, Aug 2017]
• Protein Families: ES Cell Differentiation/IPS, Transcription Factors
• Protein Pathways: TGF-beta signaling pathway