SIL1 (NM_001037633) Human Mass Spec Standard
CAT#: PH304204
SIL1 MS Standard C13 and N15-labeled recombinant protein (NP_001032722)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204204 |
Predicted MW | 52.1 kDa |
Protein Sequence |
>RC204204 protein sequence
Red=Cloning site Green=Tags(s) MAPQSLPSSRMAPLGMLLGLLMAACFTFCLSHQNLKEFALTNPEKSSTKETERKETKAEEELDAEVLEVF HPTHEWQALQPGQAVPAGSHVRLNLQTGEREAKLQYEDKFRNNLKGKRLDINTNTYTSQDLKSALAKFKE GAEMESSKEDKARQAEVKRLFRPIEELKKDFDELNVVIETDMQIMVRLINKFNSSSSSLEEKIAALFDLE YYVHQMDNAQDLLSFGGLQVVINGLNSTEPLVKEYAAFVLGAAFSSNPKVQVEAIEGGALQKLLVILATE QPLTAKKKVLFALCSLLRHFPYAQRQFLKLGGLQVLRTLVQEKGTEVLAVRVVTLLYDLVTEKMFAEEEA ELTQEMSPEKLQQYRQVHLLPGLWEQGWCEITAHLLALPEHDAREKVLQTLGVLLTTCRDRYRQDPQLGR TLASLQAEYQVLASLELQDGEDEGYFQELLGSVNSLLKELR myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001032722 |
RefSeq Size | 1996 |
RefSeq ORF | 1383 |
Synonyms | BAP; MSS; ULG5 |
Locus ID | 64374 |
UniProt ID | Q9H173, A0A0S2Z6B4 |
Cytogenetics | 5q31.2 |
Summary | This gene encodes a resident endoplasmic reticulum (ER), N-linked glycoprotein with an N-terminal ER targeting sequence, 2 putative N-glycosylation sites, and a C-terminal ER retention signal. This protein functions as a nucleotide exchange factor for another unfolded protein response protein. Mutations in this gene have been associated with Marinesco-Sjogren syndrome. Alternate transcriptional splice variants have been characterized. [provided by RefSeq, Jul 2008] |
Protein Families | Protease, Secreted Protein, Transmembrane |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402924 | SIL1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC421971 | SIL1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY402924 | Transient overexpression lysate of SIL1 homolog, endoplasmic reticulum chaperone (S. cerevisiae) (SIL1), transcript variant 2 |
USD 396.00 |
|
LY421971 | Transient overexpression lysate of SIL1 homolog, endoplasmic reticulum chaperone (S. cerevisiae) (SIL1), transcript variant 1 |
USD 396.00 |
|
PH311850 | SIL1 MS Standard C13 and N15-labeled recombinant protein (NP_071909) |
USD 2,055.00 |
|
TP304204 | Recombinant protein of human SIL1 homolog, endoplasmic reticulum chaperone (S. cerevisiae) (SIL1), transcript variant 1 |
USD 823.00 |
|
TP311850 | Recombinant protein of human SIL1 homolog, endoplasmic reticulum chaperone (S. cerevisiae) (SIL1), transcript variant 2 |
USD 748.00 |
|
TP721097 | Purified recombinant protein of Human SIL1 homolog, endoplasmic reticulum chaperone (S. cerevisiae) (SIL1), transcript variant 1 |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review