SIL1 (NM_022464) Human Mass Spec Standard

CAT#: PH311850

SIL1 MS Standard C13 and N15-labeled recombinant protein (NP_071909)

Product Images

Coomassie blue staining of purified SIL1 protein (Cat# TP311850). The protein was produced from HEK293T cells transfected with SIL1 cDNA clone (Cat# RC211850) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC211850
• Predicted MW: 48.8 kDa
• Protein Sequence:
  Sequence Link

  >RC211850 representing NM_022464
  Red=Cloning site Green=Tags(s)
  
  MAPQSLPSSRMAPLGMLLGLLMAACFTFCLSHQNLKEFALTNPEKSSTKETERKETKAEEELDAEVLEVF
  HPTHEWQALQPGQAVPAGSHVRLNLQTGEREAKLQYEDKFRNNLKGKRLDINTNTYTSQDLKSALAKFKE
  GAEMESSKEDKARQAEVKRLFRPIEELKKDFDELNVVIETDMQIMVRLINKFNSSSSSLEEKIAALFDLE
  YYVHQMDNAQDLLSFGGLQVVINGLNSTEPLVKEYAAFVLGAAFSSNPKVQVEAIEGGALQKLLVILATE
  QPLTAKKKVLFALCSLLRHFPYAQRQFLKLGGLQVLRTLVQEKGTEVLAVRVVTLLYDLVTEKMFAEEEA
  ELTQEMSPEKLQQYRQVHLLPGLWEQGWCEITAHLLALPEHDAREKVLQTLGVLLTTCRDRYRQDPQLGR
  TLASLQAEYQVLASLELQDGEDEGYFQELLGSVNSLLKELR
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_071909
• RefSeq Size: 1815
• RefSeq ORF: 1383
• Synonyms: BAP; MSS; ULG5
• Locus ID: 64374
• UniProt ID: Q9H173, A0A0S2Z6B4
• Cytogenetics: 5q31.2
• Summary: This gene encodes a resident endoplasmic reticulum (ER), N-linked glycoprotein with an N-terminal ER targeting sequence, 2 putative N-glycosylation sites, and a C-terminal ER retention signal. This protein functions as a nucleotide exchange factor for another unfolded protein response protein. Mutations in this gene have been associated with Marinesco-Sjogren syndrome. Alternate transcriptional splice variants have been characterized. [provided by RefSeq, Jul 2008]
• Protein Families: Protease, Secreted Protein, Transmembrane