Oncostatin M (OSM) (NM_020530) Human Mass Spec Standard

CAT#: PH304277

OSM MS Standard C13 and N15-labeled recombinant protein (NP_065391)

Product Images

Coomassie blue staining of purified OSM protein (Cat# TP304277). The protein was produced from HEK293T cells transfected with OSM cDNA clone (Cat# RC204277) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204277
• Predicted MW: 28.5 kDa
• Protein Sequence:
  Sequence Link

  >RC204277 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGVLLTQRTLLSLVLALLFPSMASMAAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKL
  REHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMAR
  PNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFS
  KWGESPNRSRRHSPHQALRKGVRRTRPSRKGKRLMTRGQLPR
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_065391
• RefSeq Size: 1869
• RefSeq ORF: 756
• Synonyms: MGC20461
• Locus ID: 5008
• UniProt ID: P13725
• Cytogenetics: 22q12.2
• Summary: 'This gene encodes a member of the leukemia inhibitory factor/oncostatin-M (LIF/OSM) family of proteins. The encoded preproprotein is proteolytically processed to generate the mature protein. This protein is a secreted cytokine and growth regulator that inhibits the proliferation of a number of tumor cell lines. This protein also regulates the production of other cytokines, including interleukin 6, granulocyte-colony stimulating factor and granulocyte-macrophage colony stimulating factor in endothelial cells. This gene and the related gene, leukemia inhibitory factor, also present on chromosome 22, may have resulted from the duplication of a common ancestral gene. Alternative splicing results in multiple transcript variants, at least one of which encodes an isoform that is proteolytically processed. [provided by RefSeq, Jan 2016]'
• Protein Families: Druggable Genome, ES Cell Differentiation/IPS, Secreted Protein, Stem cell relevant signaling - DSL/Notch pathway, Stem cell relevant signaling - JAK/STAT signaling pathway
• Protein Pathways: Cytokine-cytokine receptor interaction, Jak-STAT signaling pathway