Oncostatin M (OSM) (NM_020530) Human Recombinant Protein
CAT#: TP304277
Recombinant protein of human oncostatin M (OSM)
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204277 protein sequence
Red=Cloning site Green=Tags(s) MGVLLTQRTLLSLVLALLFPSMASMAAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKL REHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMAR PNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFS KWGESPNRSRRHSPHQALRKGVRRTRPSRKGKRLMTRGQLPR myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 25.7 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_065391 |
Locus ID | 5008 |
UniProt ID | P13725 |
Cytogenetics | 22q12.2 |
Refseq Size | 1869 |
Refseq ORF | 756 |
Summary | This gene encodes a member of the leukemia inhibitory factor/oncostatin-M (LIF/OSM) family of proteins. The encoded preproprotein is proteolytically processed to generate the mature protein. This protein is a secreted cytokine and growth regulator that inhibits the proliferation of a number of tumor cell lines. This protein also regulates the production of other cytokines, including interleukin 6, granulocyte-colony stimulating factor and granulocyte-macrophage colony stimulating factor in endothelial cells. This gene and the related gene, leukemia inhibitory factor, also present on chromosome 22, may have resulted from the duplication of a common ancestral gene. Alternative splicing results in multiple transcript variants, at least one of which encodes an isoform that is proteolytically processed. [provided by RefSeq, Jan 2016] |
Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Secreted Protein, Stem cell relevant signaling - DSL/Notch pathway, Stem cell relevant signaling - JAK/STAT signaling pathway |
Protein Pathways | Cytokine-cytokine receptor interaction, Jak-STAT signaling pathway |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412433 | OSM HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY412433 | Transient overexpression lysate of oncostatin M (OSM) |
USD 396.00 |
|
PH304277 | OSM MS Standard C13 and N15-labeled recombinant protein (NP_065391) |
USD 2,055.00 |
|
TP720609 | Purified recombinant protein of Human oncostatin M (OSM) |
USD 330.00 |
|
TP723340 | Purified recombinant protein of Human oncostatin M (OSM). |
USD 240.00 |
|
TP723341 | Purified recombinant protein of Human oncostatin M (OSM). |
USD 240.00 |
|
TP750016 | Recombinant protein of human Oncostatin M (OSM) produced in E. coli. |
USD 425.00 |
{0} Product Review(s)
Be the first one to submit a review