Oncostatin M (OSM) (NM_020530) Human Recombinant Protein
CAT#: TP723341
Purified recombinant protein of Human oncostatin M (OSM).
Product Images
Specifications
Product Data | |
Species | Human |
Expression Host | E. coli |
Expression cDNA Clone or AA Sequence |
AAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSRRHSPHQALRKGVRRTRPSRKGKRLMTRGQLPR
|
Tag | Tag Free |
Predicted MW | 25.7 kDa |
Concentration | Resuspend the protein in the desired concentration in proper buffer |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
Bioactivity | ED50 as determined by the dose-dependent stimulation of the proliferation of human TF-1 cells is less than or equal to 2 ng/ml, corresponding to a specific activity of > 5 x 10^5 units/mg. |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_065391 |
Locus ID | 5008 |
UniProt ID | P13725 |
Cytogenetics | 22q12.2 |
Refseq Size | 1869 |
Refseq ORF | 756 |
Synonyms | MGC20461 |
Summary | 'This gene encodes a member of the leukemia inhibitory factor/oncostatin-M (LIF/OSM) family of proteins. The encoded preproprotein is proteolytically processed to generate the mature protein. This protein is a secreted cytokine and growth regulator that inhibits the proliferation of a number of tumor cell lines. This protein also regulates the production of other cytokines, including interleukin 6, granulocyte-colony stimulating factor and granulocyte-macrophage colony stimulating factor in endothelial cells. This gene and the related gene, leukemia inhibitory factor, also present on chromosome 22, may have resulted from the duplication of a common ancestral gene. Alternative splicing results in multiple transcript variants, at least one of which encodes an isoform that is proteolytically processed. [provided by RefSeq, Jan 2016]' |
Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Secreted Protein, Stem cell relevant signaling - DSL/Notch pathway, Stem cell relevant signaling - JAK/STAT signaling pathway |
Protein Pathways | Cytokine-cytokine receptor interaction, Jak-STAT signaling pathway |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412433 | OSM HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY412433 | Transient overexpression lysate of oncostatin M (OSM) |
USD 325.00 |
|
PH304277 | OSM MS Standard C13 and N15-labeled recombinant protein (NP_065391) |
USD 2,055.00 |
|
TP304277 | Recombinant protein of human oncostatin M (OSM) |
USD 823.00 |
|
TP720609 | Purified recombinant protein of Human oncostatin M (OSM) |
USD 300.00 |
|
TP723340 | Purified recombinant protein of Human oncostatin M (OSM). |
USD 240.00 |
|
TP750016 | Recombinant protein of human Oncostatin M (OSM) produced in E. coli. |
USD 425.00 |
{0} Product Review(s)
Be the first one to submit a review