FAIM1 (FAIM) (NM_001033032) Human Mass Spec Standard

CAT#: PH304411

FAIM MS Standard C13 and N15-labeled recombinant protein (NP_001028204)

Product Images

Coomassie blue staining of purified FAIM protein (Cat# TP304411). The protein was produced from HEK293T cells transfected with FAIM cDNA clone (Cat# RC204411) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204411
• Predicted MW: 20.2 kDa
• Protein Sequence:
  Sequence Link

  >RC204411 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MTDLVAVWDVALSDGVHKIEFEHGTTSGKRVVYVDGKEEIRKEWMFKLVGKETFYVGAAKTKATINIDAI
  SGFAYEYTLEINGKSLKKYMEDRSKTTNTWVLHMDGENFRIVLEKDAMDVWCNGKKLETAGEFVDDGTET
  HFSIGNHDCYIKAVSSGKRKEGIIHTLIVDNREIPEIAS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001028204
• RefSeq Size: 1104
• RefSeq ORF: 537
• Synonyms: FAIM1
• Locus ID: 55179
• UniProt ID: Q9NVQ4
• Cytogenetics: 3q22.3
• Summary: The protein encoded by this gene protects against death receptor-triggered apoptosis and regulates B-cell signaling and differentiation. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2011]