FAIM1 (FAIM) (NM_001033032) Human Recombinant Protein

CAT#: TP304411

Recombinant protein of human Fas apoptotic inhibitory molecule (FAIM), transcript variant 3

Product Images

Coomassie blue staining of purified FAIM protein (Cat# TP304411). The protein was produced from HEK293T cells transfected with FAIM cDNA clone (Cat# RC204411) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC204411 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MTDLVAVWDVALSDGVHKIEFEHGTTSGKRVVYVDGKEEIRKEWMFKLVGKETFYVGAAKTKATINIDAI
  SGFAYEYTLEINGKSLKKYMEDRSKTTNTWVLHMDGENFRIVLEKDAMDVWCNGKKLETAGEFVDDGTET
  HFSIGNHDCYIKAVSSGKRKEGIIHTLIVDNREIPEIAS
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 20 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001028204
• Locus ID: 55179
• UniProt ID: Q9NVQ4
• Cytogenetics: 3q22.3
• Refseq Size: 1104
• Refseq ORF: 537
• Synonyms: FAIM1
• Summary: The protein encoded by this gene protects against death receptor-triggered apoptosis and regulates B-cell signaling and differentiation. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2011]