CD84 (NM_003874) Human Mass Spec Standard

CAT#: PH304477

CD84 MS Standard C13 and N15-labeled recombinant protein (NP_003865)

Product Images

Coomassie blue staining of purified CD84 protein (Cat# TP304477). The protein was produced from HEK293T cells transfected with CD84 cDNA clone (Cat# RC204477) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204477
• Predicted MW: 36.9 kDa
• Protein Sequence:
  Sequence Link

  >RC204477 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAQHHLWILLLCLQTWPEAAGKDSEIFTVNGILGESVTFPVNIQEPRQVKIIAWTSKTSVAYVTPGDSET
  APVVTVTHRNYYERIHALGPNYNLVISDLRMEDAGDYKADINTQADPYTTTKRYNLQIYRRLGKPKITQS
  LMASVNSTCNVTLTCSVEKEEKNVTYNWSPLGEEGNVLQIFQTPEDQELTYTCTAQNPVSNNSDSISARQ
  LCADIAMGFRTHHTGLLSVLAMFFLLVLILSSVFLFRLFKRRQDAASKKTIYTYIMASRNTQPAESRIYD
  EILQSKVLPSKEEPVNTVYSEVQFADKMGKASTQDSKPPGTSSYEIVI
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_003865
• RefSeq Size: 8245
• RefSeq ORF: 984
• Synonyms: hCD84; LY9B; mCD84; SLAMF5
• Locus ID: 8832
• UniProt ID: Q9UIB8
• Cytogenetics: 1q23.3
• Summary: This gene encodes a membrane glycoprotein that is a member of the signaling lymphocyte activation molecule (SLAM) family. This family forms a subset of the larger CD2 cell-surface receptor Ig superfamily. The encoded protein is a homophilic adhesion molecule that is expressed in numerous immune cells types and is involved in regulating receptor-mediated signaling in those cells. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Oct 2011]
• Protein Families: Druggable Genome, Transmembrane