CD84 (NM_003874) Human Recombinant Protein
CAT#: TP304477
Recombinant protein of human CD84 molecule (CD84)
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204477 protein sequence
Red=Cloning site Green=Tags(s) MAQHHLWILLLCLQTWPEAAGKDSEIFTVNGILGESVTFPVNIQEPRQVKIIAWTSKTSVAYVTPGDSET APVVTVTHRNYYERIHALGPNYNLVISDLRMEDAGDYKADINTQADPYTTTKRYNLQIYRRLGKPKITQS LMASVNSTCNVTLTCSVEKEEKNVTYNWSPLGEEGNVLQIFQTPEDQELTYTCTAQNPVSNNSDSISARQ LCADIAMGFRTHHTGLLSVLAMFFLLVLILSSVFLFRLFKRRQDAASKKTIYTYIMASRNTQPAESRIYD EILQSKVLPSKEEPVNTVYSEVQFADKMGKASTQDSKPPGTSSYEIVI myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 36.7 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_003865 |
Locus ID | 8832 |
UniProt ID | Q9UIB8 |
Cytogenetics | 1q23.3 |
Refseq Size | 8245 |
Refseq ORF | 984 |
Synonyms | hCD84; LY9B; mCD84; SLAMF5 |
Summary | This gene encodes a membrane glycoprotein that is a member of the signaling lymphocyte activation molecule (SLAM) family. This family forms a subset of the larger CD2 cell-surface receptor Ig superfamily. The encoded protein is a homophilic adhesion molecule that is expressed in numerous immune cells types and is involved in regulating receptor-mediated signaling in those cells. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Oct 2011] |
Protein Families | Druggable Genome, Transmembrane |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401277 | CD84 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC432804 | CD84 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC432917 | CD84 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY401277 | Transient overexpression lysate of CD84 molecule (CD84) |
USD 396.00 |
|
LY432804 | Transient overexpression lysate of CD84 molecule (CD84), transcript variant 3 |
USD 396.00 |
|
LY432917 | Transient overexpression lysate of CD84 molecule (CD84), transcript variant 1 |
USD 396.00 |
|
PH304477 | CD84 MS Standard C13 and N15-labeled recombinant protein (NP_003865) |
USD 2,055.00 |
|
TP329804 | Purified recombinant protein of Homo sapiens CD84 molecule (CD84), transcript variant 3. |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review