RND3 (NM_005168) Human Mass Spec Standard

CAT#: PH304479

RND3 MS Standard C13 and N15-labeled recombinant protein (NP_005159)

Product Images

Coomassie blue staining of purified RND3 protein (Cat# TP304479). The protein was produced from HEK293T cells transfected with RND3 cDNA clone (Cat# RC204479) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204479
• Predicted MW: 27.4 kDa
• Protein Sequence:
  Sequence Link

  >RC204479 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MKERRASQKLSSKSIMDPNQNVKCKIVVVGDSQCGKTALLHVFAKDCFPENYVPTVFENYTASFEIDTQR
  IELSLWDTSGSPYYDNVRPLSYPDSDAVLICFDISRPETLDSVLKKWKGEIQEFCPNTKMLLVGCKSDLR
  TDVSTLVELSNHRQTPVSYDQGANMAKQIGAATYIECSALQSENSVRDIFHVATLACVNKTNKNVKRNKS
  QRATKRISHMPSRPELSAVATDLRKDKAKSCTVM
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_005159
• RefSeq Size: 2712
• RefSeq ORF: 732
• Synonyms: ARHE; memB; Rho8; RhoE
• Locus ID: 390
• UniProt ID: P61587
• Cytogenetics: 2q23.3
• Summary: 'This gene encodes a protein which is a member of the small GTPase protein superfamily. The encoded protein binds only GTP but has no GTPase activity, and appears to act as a negative regulator of cytoskeletal organization leading to loss of adhesion. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Dec 2011]'