RND3 (NM_005168) Human Recombinant Protein

CAT#: TP304479

Recombinant protein of human Rho family GTPase 3 (RND3)

Product Images

Rnd3 protein delivery ameliorates hemorrhagic shock and resuscitation (HSR)-induced microvascular hyperpermeability. Extravasation of intravenously infused FITC-albumin from the mesenteric microcirculation was assessed by intravital microscopy after rats underwent HSR. The intensity in extravascular spaces adjacent to postcapillary venules increased over time; this increase was prevented with the infusion of Rnd3 (OriGene TP304479). Figure cited from J Am Heart Assoc, PMID: 27048969

• 

  Coomassie blue staining of purified RND3 protein (Cat# TP304479). The protein was produced from HEK293T cells transfected with RND3 cDNA clone (Cat# RC204479) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC204479 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MKERRASQKLSSKSIMDPNQNVKCKIVVVGDSQCGKTALLHVFAKDCFPENYVPTVFENYTASFEIDTQR
  IELSLWDTSGSPYYDNVRPLSYPDSDAVLICFDISRPETLDSVLKKWKGEIQEFCPNTKMLLVGCKSDLR
  TDVSTLVELSNHRQTPVSYDQGANMAKQIGAATYIECSALQSENSVRDIFHVATLACVNKTNKNVKRNKS
  QRATKRISHMPSRPELSAVATDLRKDKAKSCTVM
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 27.2 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Bioactivity: Ex vivo tissue treatment (PMID: 27048969)
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_005159
• Locus ID: 390
• UniProt ID: P61587
• Cytogenetics: 2q23.3
• Refseq Size: 2712
• Refseq ORF: 732
• Synonyms: ARHE; memB; Rho8; RhoE
• Summary: This gene encodes a protein which is a member of the small GTPase protein superfamily. The encoded protein binds only GTP but has no GTPase activity, and appears to act as a negative regulator of cytoskeletal organization leading to loss of adhesion. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Dec 2011]