CTRP6 (C1QTNF6) (NM_031910) Human Mass Spec Standard

CAT#: PH304524

C1QTNF6 MS Standard C13 and N15-labeled recombinant protein (NP_114116)

Product Images

Coomassie blue staining of purified C1QTNF6 protein (Cat# TP304524). The protein was produced from HEK293T cells transfected with C1QTNF6 cDNA clone (Cat# RC204524) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204524
• Predicted MW: 30.9 kDa
• Protein Sequence:
  Sequence Link

  >RC204524 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MQWLRVRESPGEATGHRVTMVTAALGPVWAALLLFLLMCEIPMVELTFDRAVASGCQRCCDSEDPLDPAH
  VSSASSSGRPHALPEIRPYINITILKGDKGDPGPMGLPGYMGREGPQGEPGPQGSKGDKGEMGSPGAPCQ
  KRFFAFSVGRKTALHSGEDFQTLLFERVFVNLDGCFDMATGQFAAPLRGIYFFSLNVHSWNYKETYVHIM
  HNQKEAVILYAQPSERSIMQSQSVMLDLAYGDRVWVRLFKRQRENAIYSNDFDTYITFSGHLIKAEDD
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_114116
• RefSeq Size: 2954
• RefSeq ORF: 834
• Synonyms: CTFP6; CTRP6; ZACRP6
• Locus ID: 114904
• UniProt ID: Q9BXI9, A0A024R1J0
• Cytogenetics: 22q12.3
• Protein Families: Secreted Protein, Transmembrane