CTRP6 (C1QTNF6) (NM_031910) Human Recombinant Protein

CAT#: TP304524

Recombinant protein of human C1q and tumor necrosis factor related protein 6 (C1QTNF6), transcript variant 1

Product Images

Coomassie blue staining of purified C1QTNF6 protein (Cat# TP304524). The protein was produced from HEK293T cells transfected with C1QTNF6 cDNA clone (Cat# RC204524) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC204524 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MQWLRVRESPGEATGHRVTMVTAALGPVWAALLLFLLMCEIPMVELTFDRAVASGCQRCCDSEDPLDPAH
  VSSASSSGRPHALPEIRPYINITILKGDKGDPGPMGLPGYMGREGPQGEPGPQGSKGDKGEMGSPGAPCQ
  KRFFAFSVGRKTALHSGEDFQTLLFERVFVNLDGCFDMATGQFAAPLRGIYFFSLNVHSWNYKETYVHIM
  HNQKEAVILYAQPSERSIMQSQSVMLDLAYGDRVWVRLFKRQRENAIYSNDFDTYITFSGHLIKAEDD
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 30.7 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_114116
• Locus ID: 114904
• UniProt ID: Q9BXI9, A0A024R1J0
• Cytogenetics: 22q12.3
• Refseq Size: 2954
• Refseq ORF: 834
• Synonyms: CTFP6; CTRP6; ZACRP6
• Protein Families: Secreted Protein, Transmembrane