CTRP6 (C1QTNF6) (NM_031910) Human Recombinant Protein
CAT#: TP304524
Recombinant protein of human C1q and tumor necrosis factor related protein 6 (C1QTNF6), transcript variant 1
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC204524 protein sequence
Red=Cloning site Green=Tags(s) MQWLRVRESPGEATGHRVTMVTAALGPVWAALLLFLLMCEIPMVELTFDRAVASGCQRCCDSEDPLDPAH VSSASSSGRPHALPEIRPYINITILKGDKGDPGPMGLPGYMGREGPQGEPGPQGSKGDKGEMGSPGAPCQ KRFFAFSVGRKTALHSGEDFQTLLFERVFVNLDGCFDMATGQFAAPLRGIYFFSLNVHSWNYKETYVHIM HNQKEAVILYAQPSERSIMQSQSVMLDLAYGDRVWVRLFKRQRENAIYSNDFDTYITFSGHLIKAEDD myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 30.7 kDa |
| Concentration | >50 ug/mL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_114116 |
| Locus ID | 114904 |
| UniProt ID | Q9BXI9, A0A024R1J0 |
| Cytogenetics | 22q12.3 |
| Refseq Size | 2954 |
| Refseq ORF | 834 |
| Synonyms | CTFP6; CTRP6; ZACRP6 |
| Protein Families | Secreted Protein, Transmembrane |
Documents
| FAQs |
| SDS |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403130 | C1QTNF6 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC405547 | C1QTNF6 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC430589 | C1QTNF6 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY403130 | Transient overexpression lysate of C1q and tumor necrosis factor related protein 6 (C1QTNF6), transcript variant 1 |
USD 436.00 |
|
| LY405547 | Transient overexpression lysate of C1q and tumor necrosis factor related protein 6 (C1QTNF6), transcript variant 2 |
USD 436.00 |
|
| LY430589 | Transient overexpression lysate of C1q and tumor necrosis factor related protein 6 (C1QTNF6), transcript variant 2 |
USD 396.00 |
|
| PH304524 | C1QTNF6 MS Standard C13 and N15-labeled recombinant protein (NP_114116) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China