PYCR2 (NM_013328) Human Mass Spec Standard

CAT#: PH304525

PYCR2 MS Standard C13 and N15-labeled recombinant protein (NP_037460)

Product Images

Coomassie blue staining of purified PYCR2 protein (Cat# TP304525). The protein was produced from HEK293T cells transfected with PYCR2 cDNA clone (Cat# RC204525) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204525
• Predicted MW: 33.6 kDa
• Protein Sequence:
  Sequence Link

  >RC204525 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSVGFIGAGQLAYALARGFTAAGILSAHKIIASSPEMNLPTVSALRKMGVNLTRSNKETVKHSDVLFLAV
  KPHIIPFILDEIGADVQARHIVVSCAAGVTISSVEKKLMAFQPAPKVIRCMTNTPVVVQEGATVYATGTH
  ALVEDGQLLEQLMSSVGFCTEVEEDLIDAVTGLSGSGPAYAFMALDALADGGVKMGLPRRLAIQLGAQAL
  LGAAKMLLDSEQHPCQLKDNVCSPGGATIHALHFLESGGFRSLLINAVEASCIRTRELQSMADQEKISPA
  ALKKTLLDRVKLESPTVSTLTPSSPGKLLTRSLALGGKKD
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_037460
• RefSeq Size: 1771
• RefSeq ORF: 960
• Synonyms: HLD10; P5CR2
• Locus ID: 29920
• UniProt ID: Q96C36, A0A0S2Z5U6
• Cytogenetics: 1q42.12
• Summary: This gene belongs to the pyrroline-5-carboxylate reductase family. The encoded mitochondrial protein catalyzes the conversion of pyrroline-5-carboxylate to proline, which is the last step in proline biosynthesis. Alternatively spliced transcript variants have been described for this gene. [provided by RefSeq, Nov 2012]
• Protein Pathways: Arginine and proline metabolism, Metabolic pathways