PYCR2 (NM_013328) Human Recombinant Protein

CAT#: TP304525

Recombinant protein of human pyrroline-5-carboxylate reductase family, member 2 (PYCR2)

Product Images

Coomassie blue staining of purified PYCR2 protein (Cat# TP304525). The protein was produced from HEK293T cells transfected with PYCR2 cDNA clone (Cat# RC204525) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC204525 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSVGFIGAGQLAYALARGFTAAGILSAHKIIASSPEMNLPTVSALRKMGVNLTRSNKETVKHSDVLFLAV
  KPHIIPFILDEIGADVQARHIVVSCAAGVTISSVEKKLMAFQPAPKVIRCMTNTPVVVQEGATVYATGTH
  ALVEDGQLLEQLMSSVGFCTEVEEDLIDAVTGLSGSGPAYAFMALDALADGGVKMGLPRRLAIQLGAQAL
  LGAAKMLLDSEQHPCQLKDNVCSPGGATIHALHFLESGGFRSLLINAVEASCIRTRELQSMADQEKISPA
  ALKKTLLDRVKLESPTVSTLTPSSPGKLLTRSLALGGKKD
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 33.5 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_037460
• Locus ID: 29920
• UniProt ID: Q96C36, A0A0S2Z5U6
• Cytogenetics: 1q42.12
• Refseq Size: 1771
• Refseq ORF: 960
• Synonyms: HLD10; P5CR2
• Summary: This gene belongs to the pyrroline-5-carboxylate reductase family. The encoded mitochondrial protein catalyzes the conversion of pyrroline-5-carboxylate to proline, which is the last step in proline biosynthesis. Alternatively spliced transcript variants have been described for this gene. [provided by RefSeq, Nov 2012]
• Protein Pathways: Arginine and proline metabolism, Metabolic pathways