LOX 1 (OLR1) (NM_002543) Human Mass Spec Standard

CAT#: PH304704

OLR1 MS Standard C13 and N15-labeled recombinant protein (NP_002534)

Product Images

Coomassie blue staining of purified OLR1 protein (Cat# TP304704). The protein was produced from HEK293T cells transfected with OLR1 cDNA clone (Cat# RC204704) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204704
• Predicted MW: 31 kDa
• Protein Sequence:
  Sequence Link

  >RC204704 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MTFDDLKIQTVKDQPDEKSNGKKAKGLQFLYSPWWCLAAATLGVLCLGLVVTIMVLGMQLSQVSDLLTQE
  QANLTHQKKKLEGQISARQQAEEASQESENELKEMIETLARKLNEKSKEQMELHHQNLNLQETLKRVANC
  SAPCPQDWIWHGENCYLFSSGSFNWEKSQEKCLSLDAKLLKINSTADLDFIQQAISYSSFPFWMGLSRRN
  PSYPWLWEDGSPLMPHLFRVRGAVSQTYPSGTCAYIQRGAVYAENCILAAFSICQKKANLRAQ
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_002534
• RefSeq Size: 2533
• RefSeq ORF: 819
• Synonyms: CLEC8A; LOX1; LOXIN; SCARE1; SLOX1
• Locus ID: 4973
• UniProt ID: P78380, A0A024RAU0
• Cytogenetics: 12p13.2
• Summary: 'This gene encodes a low density lipoprotein receptor that belongs to the C-type lectin superfamily. This gene is regulated through the cyclic AMP signaling pathway. The encoded protein binds, internalizes and degrades oxidized low-density lipoprotein. This protein may be involved in the regulation of Fas-induced apoptosis. This protein may play a role as a scavenger receptor. Mutations of this gene have been associated with atherosclerosis, risk of myocardial infarction, and may modify the risk of Alzheimer's disease. Alternate splicing results in multiple transcript variants.[provided by RefSeq, Feb 2010]'
• Protein Families: Druggable Genome, Secreted Protein, Transmembrane
• Protein Pathways: PPAR signaling pathway