LOX 1 (OLR1) (NM_002543) Human Recombinant Protein
CAT#: TP304704
Recombinant protein of human oxidized low density lipoprotein (lectin-like) receptor 1 (OLR1)
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC204704 protein sequence
Red=Cloning site Green=Tags(s) MTFDDLKIQTVKDQPDEKSNGKKAKGLQFLYSPWWCLAAATLGVLCLGLVVTIMVLGMQLSQVSDLLTQE QANLTHQKKKLEGQISARQQAEEASQESENELKEMIETLARKLNEKSKEQMELHHQNLNLQETLKRVANC SAPCPQDWIWHGENCYLFSSGSFNWEKSQEKCLSLDAKLLKINSTADLDFIQQAISYSSFPFWMGLSRRN PSYPWLWEDGSPLMPHLFRVRGAVSQTYPSGTCAYIQRGAVYAENCILAAFSICQKKANLRAQ myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 30.8 kDa |
| Concentration | >50 ug/mL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
| Bioactivity | Binding assay (PMID: 28377266) |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_002534 |
| Locus ID | 4973 |
| UniProt ID | P78380, A0A024RAU0 |
| Cytogenetics | 12p13.2 |
| Refseq Size | 2533 |
| Refseq ORF | 819 |
| Synonyms | CLEC8A; LOX1; LOXIN; SCARE1; SLOX1 |
| Summary | This gene encodes a low density lipoprotein receptor that belongs to the C-type lectin superfamily. This gene is regulated through the cyclic AMP signaling pathway. The encoded protein binds, internalizes and degrades oxidized low-density lipoprotein. This protein may be involved in the regulation of Fas-induced apoptosis. This protein may play a role as a scavenger receptor. Mutations of this gene have been associated with atherosclerosis, risk of myocardial infarction, and may modify the risk of Alzheimer's disease. Alternate splicing results in multiple transcript variants.[provided by RefSeq, Feb 2010] |
| Protein Families | Druggable Genome, Secreted Protein, Transmembrane |
| Protein Pathways | PPAR signaling pathway |
Documents
| FAQs |
| SDS |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400904 | OLR1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC432642 | OLR1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY400904 | Transient overexpression lysate of oxidized low density lipoprotein (lectin-like) receptor 1 (OLR1) |
USD 436.00 |
|
| LY432642 | Transient overexpression lysate of oxidized low density lipoprotein (lectin-like) receptor 1 (OLR1), transcript variant 2 |
USD 436.00 |
|
| PH304704 | OLR1 MS Standard C13 and N15-labeled recombinant protein (NP_002534) |
USD 2,055.00 |
|
| TP720433 | Recombinant protein of human oxidized low density lipoprotein (lectin-like) receptor 1 (OLR1), transcript variant 2. |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China