TPST2 (NM_001008566) Human Mass Spec Standard

CAT#: PH304969

TPST2 MS Standard C13 and N15-labeled recombinant protein (NP_001008566)

Product Images

Coomassie blue staining of purified TPST2 protein (Cat# TP304969). The protein was produced from HEK293T cells transfected with TPST2 cDNA clone (Cat# RC204969) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204969
• Predicted MW: 41.9 kDa
• Protein Sequence:
  Sequence Link

  >RC204969 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MRLSVRRVLLAAGCALVLVLAVQLGQQVLECRAVLAGLRSPRGAMRPEQEELVMVGTNHVEYRYGKAMPL
  IFVGGVPRSGTTLMRAMLDAHPEVRCGEETRIIPRVLAMRQAWSKSGREKLRLDEAGVTDEVLDAAMQAF
  ILEVIAKHGEPARVLCNKDPFTLKSSVYLSRLFPNSKFLLMVRDGRASVHSMITRKVTIAGFDLSSYRDC
  LTKWNKAIEVMYAQCMEVGKEKCLPVYYEQLVLHPRRSLKLILDFLGIAWSDAVLHHEDLIGKPGGVSLS
  KIERSTDQVIKPVNLEALSKWTGHIPGDVVRDMAQIAPMLAQLGYDPYANPPNYGNPDPFVINNTQRVLK
  GDYKTPANLKGYFQVNQNSTSSHLGSS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001008566
• RefSeq Size: 2018
• RefSeq ORF: 1131
• Synonyms: TANGO13B; TPST-2
• Locus ID: 8459
• UniProt ID: O60704, A0A024R1G9
• Cytogenetics: 22q12.1
• Summary: The protein encoded by this gene catalyzes the O-sulfation of tyrosine residues within acidic regions of proteins. The encoded protein is a type II integral membrane protein found in the Golgi body. Alternative splicing produces multiple transcript variants encoding distinct isoforms. [provided by RefSeq, May 2018]
• Protein Families: Transmembrane